SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039211 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039211
Domain Number 1 Region: 928-1037
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-36
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 2 Region: 1049-1155
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-35
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 3 Region: 3151-3276
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-34
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 4 Region: 2685-2797
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-34
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 5 Region: 1387-1503
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-34
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 6 Region: 1617-1730
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-34
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 7 Region: 586-698
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-34
Family Spermadhesin, CUB domain 0.0007
Further Details:      
 
Domain Number 8 Region: 1161-1273
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-33
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 9 Region: 2224-2332
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.33e-33
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 10 Region: 3391-3503
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-32
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 11 Region: 1735-1845
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-31
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 12 Region: 3033-3145
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.06e-30
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 13 Region: 1506-1614
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-30
Family Spermadhesin, CUB domain 0.00093
Further Details:      
 
Domain Number 14 Region: 2332-2442
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-30
Family Spermadhesin, CUB domain 0.00036
Further Details:      
 
Domain Number 15 Region: 2449-2561
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-30
Family Spermadhesin, CUB domain 0.00098
Further Details:      
 
Domain Number 16 Region: 1984-2086
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-29
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 17 Region: 1854-1960
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.16e-29
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 18 Region: 1275-1384
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-27
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 19 Region: 2088-2209
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-27
Family Spermadhesin, CUB domain 0.00085
Further Details:      
 
Domain Number 20 Region: 3507-3618
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-26
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 21 Region: 2912-3034
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-26
Family Spermadhesin, CUB domain 0.00083
Further Details:      
 
Domain Number 22 Region: 471-582
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.68e-26
Family Spermadhesin, CUB domain 0.00099
Further Details:      
 
Domain Number 23 Region: 820-923
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-25
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 24 Region: 2567-2683
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-23
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 25 Region: 704-811
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-22
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 26 Region: 2801-2914
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-21
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 27 Region: 3283-3388
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-19
Family Spermadhesin, CUB domain 0.0059
Further Details:      
 
Domain Number 28 Region: 130-172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000119
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 29 Region: 429-471
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000103
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 30 Region: 260-397
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000455
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 31 Region: 389-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000404
Family EGF-type module 0.013
Further Details:      
 
Domain Number 32 Region: 167-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000134
Family EGF-type module 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039211   Gene: ENSBTAG00000005072   Transcript: ENSBTAT00000039417
Sequence length 3620
Comment pep:known chromosome:UMD3.1:13:31559727:31826838:-1 gene:ENSBTAG00000005072 transcript:ENSBTAT00000039417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLFLGSLVILLTFAASYSEDGGLALQRQKRNIDLQQPRMTAERGNLVFLTGSAQNIEF
RTGSLGRIKLNDEDVGECFHQIQKNKDDITNLKRTTVGLPQNISNQIHQLDSKLADLERK
LQSLQQTLDRKVCSSNPCQHGGTCLNLPDSFFCMCPSQWKGPLCSVDVNECEIYSGTPLG
CQNGATCINTAGSYSCLCSPETHGPQCASKYDDCEGGSKARCMHGICEDLVRVKAGEPEY
SCICDAGWKAPSNSTACTLDVDECNLWPAPCSELVRCFNTPGSFYCGACPTGWQGNGYIC
EDINECEINNGGCSVAPLVECINTHGSYHCHSCPPGYQGDGRVCTLVDRCSVNNGGCHPQ
ASCSLALGSLPLCTCLPGYTGNGYGPNGCVQLSNICLSRPCVNGQCIETVSGYVCKCESG
WTSVNCTENINECLSNPCLNGGTCVDGVNAFSCECTHFWTGFLCHIPQEVCGESLSGMNG
SFSFVSPDVAYAHDINCFWVIHTEEGKVLRITFTFFQLEPTNNCPHEFLQIHDGDSSAAH
QLGRFCGSSPPQELLSSDNALYFHLYSEHLRSERGFTIRWETQLPECGGMLTGTYGSIKS
PGYPGKYPPGRDCVWRVITSPDLLITFTFGTLSLEHHDDCSKDYLEIRDGPLHQDPVLGK
FCTTLSAPPLQTTGPFARIHFHSDNEINDQGFLITYLTSPSDLQCGGNYTDPEGLLFADL
SGPFMHDRQCIYTIKQPPGEQIQVNFTVVELEGQSGCSHSYIEVRDDQTLLGKVCGNETL
SHIKSITNSIWIRLKMDVSVVRASFSAVYQVACGGELTGEGIIRSPFYPNVYPGERVCVW
TIRQPQSQVVLLNFTAFDMGGSAHCDTDYVEVGSSSILGSLKNEKHCGADIPSFITSVYN
SLHVIFVKSSSADNHGFVAEFSSAALACGKVLTESTGSIQSPGYPNIYPHGISCTWHIIV
QPGHLIHLRFREFHLEFHYNCTKDYLEVYDTGSQTFLGRYCGKSIPPSLTSNDNSVRLTF
VADSDLAYEGFLINYEATDASAACLNDYTEESGTFTSPNFPGFYPNNLECIYRITVESSQ
QIALHFTNFSLEDAIGSTCVADYVEIRNGGYENSPLLGQYCGSNLPPRIISHSNKLWLKF
KSDFFGSGPGFSAYWDGSLTGCGGNLTTSTGTFTSPNYPMPYYHSSECSWWLKASRGSPF
LLEFEDFHLEYHPNCSQDYLAVYDGSSTSSHLLTRLCGNEKPSVIRSSGDSMSLKLRTDE
GQQGGGFLVKYQQTCDNVVIVNQTYGTLESIHYPNPYSVNQRCNWTIQATTGNTVNYTFL
AFELEYYTNCSTDYLELYDGPQRMGRFCGTDIPPSGSTTGSKFHVLFYTDGVSHHEKGFQ
MQWFIQGCGGELSGDTGSFSSPGYPNRYPANKECIWYIHTAPGSSIQLTIHDFDVEYHAR
CNFDVLEIYGGPDFHSPRIAQLCVQRSSENPMQVSSTGNELAIRFKTDSSINGRGFNVSW
RAVPGGCGGIFQAPSGEIHSPNYPSPYRSNTECTWVIQVEKHHRVLLNFTDFDLEPQDSC
VLAFDGVSSATARLAGVCGRQQLRNPIISSGNSLFLRFQSGPSRQSRGFRAYFRQACGGH
FLTDSVDTISSPLFPNNYPSNQNCSWIIQAQPPFNHITLSFSHFGLESSTPCTRDFVEVL
DGSHDDAPLRGRYCGPSLPHPITSFSNALMLKFVSDSTVNFGGFHATYAASTSACGGIFH
MAEGIFNSPGYPEVYPANVECVWNVVSSPGNQLQLSFIAFQLEESQDCSRDFVEVREGNA
TGRLVGRYCGNALPLNYSSAVGHILWIRFVSDGSGTGMGFQAAFASIFGNDNIVGTHGKI
ASPLWPGNYPHNSNYQWIVNVEESQVIHARILEMDMEGTLNCYYDKLKIYDGAGIHSRLV
GTYCGTQTDSFSSTGSSLTFQFSSDSSISGRGFLLEWFAMNASVGPVPTIATGACGGFLQ
TGDTPVFLYSPGWPESYSNGANCMWLIQAPDSTVELNILSLDIESHSTCSYDKLVIRDGD
NSMAQELAVLCGREVPGPIRSTGEYMVIHFTSDFSVTGAGFNASFHKSCGGYLHADRGII
TSPRYPETYTPNLNCSWHVQVQSGLTIAVHFEQPFQILNRDSSCNQGDYLVLKNGPDLSS
PPLGPHGGNGRFCGSHPSSTLFTSDNQMFVQFISDNSNEGQGFKITYEAKSLACGGNIYI
HNADSTGYVTSPNHPDHYPQHADCIWLIAAPPGKLIRLQFEGQFSIEVTPNCTSNYLELR
DGADSNAPILSKFCGTSLPISQLSSGEVMYLRFRSDNSPTHVGFKAKYSIAPCGGAVTGQ
SGVIESNGYPTQPYTDDLFCEWRLRGPLGHYLTIHFEGFNLQNSSGCERDFVEIWENHTS
GTLLGRYCGSSIPSSMDTSSNVALVRFVTDGSVSASGFRLRFDSSLEACGGDLQGPSGTF
TSPNYRSPNPHGWMCEWRITVQEGRRVTLTFDSLRLEAHPWCSSEHVTVFNGIRSNSPQL
EKLCRSMNGSNEIESSGNTMKVVYFTDGSRPYGGFIASYTSNEDAVCGGSLTSFPKGNFT
SPGYDGVSNYSRNLNCEWMLSNPNQGNSSIYIHFEDFYLETHQDCQSDVLEFRVDNADGL
LIWRLCGSSKPRMPLVIPYPEVWIHFVTNERVEHVGFHAQYSFTDCGGIQIGDSGVISSP
NYPAAYDSLTHCSWLLEAPQGHTINLTFSDFDVEAHENCAWDSVTVRNGGSPGSPIIGHY
CGILNPGTIQSGSNQLVVIFNTDHSIQHGGFYATWSSETLGCGGVLHLNNGTIRSPHWPQ
NFPENSRCSWTVITHQSKHLEISFDNNFLIPSGDGQCQNSFVKVWGDTQESSQTLLATSC
GNVAPRPITTPRNVFTAVFQSQEAPAQGFSASFVSRCGGNFTSPSGYIVSPNYPKQYDNN
MNCTYIIEASPLSVIVLTLVSFHLEAHSAVTGSCVNDGVHIIRGYSLSSTPLATLCGEDS
LSPLTTSGPVLLNFYSNAHTTDLGFKFSYRITSCGGVFNLSTGVIKSPLYTYSNYPDDVH
CLYTITVRSNRVIQLKFNDFYVVPSASCSEDYLAVYDGSNISDPLLGQFCGSNLPPNIRS
SNNSMFLVFKTDSIQTARGWRITFRQTLGPQQGCGGYLTGSDHSFASPDSDSNGRYDKGL
NCVWFITAPVNKVIKLTFHTFALEAATTLRRCIYDYVKLYDGDSENANLAGTFCGSTVPA
PFISSGNFLTVQFVSDLSLEREGFNATYTIMDMPCGGTFNATRTPQSISSPNSSDPDVPL
ATCTWVIEAPLHQQVEITVWAFQLHSQDCNQNYLEFQDPPESNGNPGIRFCGGNVSAVPT
FYSSTSTAVIVFKSEVFSINSRVGFTYKIADCNREYKKAFGNLRSPGWPSDYASNVDCTT
VLTAPDNHTISLFFHSFGIEDSSGCTHDFLEVRNGSESSSPLLGTYCGTLLPNPIFSQSH
ELYLRFKSDGATSGRGYEIIWTSSPSGCGGTLYGDSGSVTSPGYPGTYPNNTHCEWAILA
PAGRPVTVSFYFISIDDPGECVQNYLLLYDGPDANSPSSGPYCGADTDIAPFVASSHCVF
IKFHAEYAARPSALRLTWAS
Download sequence
Identical sequences F1MKV7
NP_001179504.1.59421 NP_001179504.1.76553 ENSBTAP00000039211 ENSBTAP00000039211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]