SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039261 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039261
Domain Number 1 Region: 387-413,441-978
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.92e-111
Family alpha-mannosidase, C-terminal domain 0.00025
Further Details:      
 
Domain Number 2 Region: 3-304
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.56e-45
Family alpha-mannosidase 0.00017
Further Details:      
 
Domain Number 3 Region: 310-406
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 0.00000000049
Family alpha-mannosidase, domain 2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039261   Gene: ENSBTAG00000017829   Transcript: ENSBTAT00000039467
Sequence length 979
Comment pep:novel chromosome:UMD3.1:6:104341538:104377801:-1 gene:ENSBTAG00000017829 transcript:ENSBTAT00000039467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STQAYVTTVYTSVVEDLTRNKQHRFIIVDQEFFRLWWDGVASAKQKVQSVRGLLAQPLSL
EAGPSAFPSLFSDGLRTAWLNITKGHGFLYETFGIQPQFSWQVYSFGASTTTPTLFALAG
FSGHIISRIDYDLKVTMQQKQEMQFVWRGSKSLMAQQETFTHDLDENGYCFYCHLIITIF
SILQFNSILVYLNQCMDEMFTPSDMPVSKDNIQMYTKKLLNNTWEQFIWFQIGHVLWPWE
EDMKGFNASVQFANMDRLMNYINSLTPKTGVFLEYATDYFQAIHSTHISWHIRNHHNFLP
YSSDMFHSGTGFYASRSGLKGLARRASALLYAGESMFTRFMLAPHRFLDQAWGLQQLQKL
RWAVSEVTPHLSVAGGLTPPKVRDMFVEHLGAGMQGVCKLMASIIQQGEMGEDFMDPQLL
EGHPPTPELGNQNHRPEPGGHFAMVYHPLAWTVTTIVTPTADFPEVNLTDETGNPVPAQV
QNSKETPSAYDLLVLTTIPGFSYRHYVIRPMRRAQKDTQETGASVDSTKQFGRRPRTNRR
QAGRRPVHMENDCYTVYLDKDTNLMHSIWERQSNRTIQVTQEFMEYHDNSDEGQISISNN
YVFAPNGTSKPVWAAVEMEILEGQLLTEIQRCFYRTVNDRDPTYTIYSQLARGPPGADGE
LLCHRIKQEYRVGPLELNHEAIWRTSTHLNTAQVLYSDNNGYQMQRRAYKQYMVNTITRN
YYPMTQSAFIQDRQSRLVLLSEQVHGVSSQGSGQMEDFFHRQLLIKQQWALSVNVTLNDT
SVVHSVLWLLLGPSTLTRDLGQRSGVALQHRPVVLIRELSGKRATFQCSCHPCPGQEAVM
LPPSLHLQILSIPGWTYNLNHTKHLQNLQKGHQGQAKVDFCRVLLWLHHLYEKGQHPVLS
QPVMVNLQSVLWSLGSVVSMEECSLTGTWDVGTLQRWSWKIQDGHQHRGGAHRPLPPHRG
PDIAIHPKEIRMFFIHFQE
Download sequence
Identical sequences F1MPT2
ENSBTAP00000039261 ENSBTAP00000039261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]