SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039366 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039366
Domain Number 1 Region: 662-941
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.55e-84
Family Protein kinases, catalytic subunit 0.000000000762
Further Details:      
 
Domain Number 2 Region: 53-225
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.53e-71
Family Ephrin receptor ligand binding domain 0.00000128
Further Details:      
 
Domain Number 3 Region: 350-553
Classification Level Classification E-value
Superfamily Fibronectin type III 7.86e-41
Family Fibronectin type III 0.0000824
Further Details:      
 
Domain Number 4 Region: 960-1025
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.94e-21
Family SAM (sterile alpha motif) domain 0.00052
Further Details:      
 
Domain Number 5 Region: 281-352,388-403
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000141
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039366   Gene: ENSBTAG00000009438   Transcript: ENSBTAT00000039576
Sequence length 1030
Comment pep:known_by_projection chromosome:UMD3.1:6:82560093:82962887:-1 gene:ENSBTAG00000009438 transcript:ENSBTAT00000039576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSGPRGAGRLRLPSTPASLAGCSSAPRRAPLWTCLLLCAALRTLLASPSNEVNLLDSR
TVMGDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISNEGASRIF
IELKFTLRDCNSLPGGLGTCKETFNMYYFESDNENGRNIKENQYIKIDTIAADESFTELD
LGDRVMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVYYKKCPSVVRHLAVFPDTI
TGADSSQLLEVAGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKNGTCQVCRP
GFFKASPHSQSCSKCPPHSYTHEEASTSCVCEKDYFRRESDPPTMACTRPPSAPRNAISN
VNETSVFLEWIPPADTGGRKDVSYYIACKKCNSHAGVCDECGGHVRYLPQQIGLKNTSVM
VVDLLAHTNYTFEIEAVNGVSDLSPGARQYVSVNVTTNQAAPSPVTNVKKGKIAKNSISL
SWQEPDRPNGIILEYEIKYFEKDQETSYTIIKSKETSITAEGLKPASVYVFQIRARTAAG
YGVFSRRFEFETIPVFAASSDQSQIPIIAVSVTVGVILLAVVIGFLLSGSCCDCGCGRAS
SLCAVAHPSLIWRCGYSKAKQDPEEEKMHFHNGHIKLPGVRTYIDPHTYEDPNQAVHEFA
KEIEASCITIERVIGAGEFGEVCSGRLKLPGKRELPVAIKTLKVGYTEKQRRDFLGEASI
MGQFDHPNIIHLEGVVTKSKPVMIVTEYMENGSLDTFLKKNDGQFTVIQLVGMLRGIAAG
MKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIPIRWTAP
EAIAFRKFTSASDVWSYGIVMWEVVSYGERPYWEMTNQDVIKAVEEGYRLPSPMDCPAAL
YQLMLDCWQKDRNSRPKFEEIVNMLDKLIRNPSSLKTLVNASSRVSNLLAEHGSLGSGAY
RSVGEWLEAIKMGRYTEIFMENGYSSMDAVAQVTLEDLRRLGVTLVGHQKKIMNSLQEMK
VQLVNGMVPL
Download sequence
Identical sequences F1N781
XP_002688357.1.76553 XP_015319256.1.59421 ENSBTAP00000039366 ENSBTAP00000039366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]