SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039368 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039368
Domain Number 1 Region: 626-934
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-75
Family Protein kinases, catalytic subunit 0.00000000256
Further Details:      
 
Domain Number 2 Region: 32-204
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.25e-74
Family Ephrin receptor ligand binding domain 0.000000906
Further Details:      
 
Domain Number 3 Region: 331-537
Classification Level Classification E-value
Superfamily Fibronectin type III 3.06e-42
Family Fibronectin type III 0.00007
Further Details:      
 
Domain Number 4 Region: 929-1004
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.61e-22
Family SAM (sterile alpha motif) domain 0.00028
Further Details:      
 
Domain Number 5 Region: 260-322
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000667
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039368   Gene: ENSBTAG00000021420   Transcript: ENSBTAT00000039578
Sequence length 1007
Comment pep:known chromosome:UMD3.1:9:57622907:57830272:1 gene:ENSBTAG00000021420 transcript:ENSBTAT00000039578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFQTRHPSWIILCYIWLLHFAHTGEAQAAKEVLLLDSKAQQTELEWISSPPNGWEEISG
LDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCK
ETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKK
GFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEE
EAENSPRMHCSAEGEWLVPIGKCICKAGFQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHS
FSDKEGSSRCDCEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGR
NDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNG
VSDLSRSQRLFAAVSVTTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKY
YEKDQRERTYSTLKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATG
KMFEATAVSSEQNPVIIIAVVAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELYFHF
KFPGTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDV
AVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALD
AFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLS
RVIEDDPEAVYTTTVRKSLLLHLFIFLPIFLPRKQALQYRKFTSASDVWSYGIVMWEVMS
YGERPYWDMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILD
KMIRNPNSLKTPLGTCSRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNS
LESVARMTIEDVMSLGITLVGHQKKIMSSIQTMRAQMLHLHGTGIQV
Download sequence
Identical sequences F1N780
ENSBTAP00000039368 ENSBTAP00000039368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]