SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039639 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039639
Domain Number 1 Region: 349-631
Classification Level Classification E-value
Superfamily Kelch motif 5.89e-47
Family Kelch motif 0.0037
Further Details:      
 
Domain Number 2 Region: 769-915
Classification Level Classification E-value
Superfamily C-type lectin-like 3.67e-23
Family C-type lectin domain 0.0037
Further Details:      
 
Domain Number 3 Region: 115-237
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.13e-22
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 4 Region: 1049-1095
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000544
Family Laminin-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000039639
Domain Number - Region: 86-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000628
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 235-272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00398
Family EGF-type module 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039639   Gene: ENSBTAG00000003848   Transcript: ENSBTAT00000039853
Sequence length 1415
Comment pep:known chromosome:UMD3.1:13:52003104:52192979:-1 gene:ENSBTAG00000003848 transcript:ENSBTAT00000039853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAAATEARLRRTVVTPAPTSRNGRRCRDWDATRAGRPGLRTGLRLPRRWRRLLLLLLPP
LLLLPWAAEAAAAAASVSGSAAAEAKECDRPCVNGGRCNPGTGQCVCPAGWVGEQCQHCG
GRFRLTGSSGFITDGPGNYKYKTKCTWLIEGQPNRIMRLRFNHFATECSWDHLYVYDGDS
IYAPLVAAFSGLIVPERDGNETVPEVVATSGYALLHFFSDAAYNLTGFNITYNFDMCPNN
CSGRGECKISNSSNTVQCECSENWKGEACDIPHCVNNCGFPHRGICNSSDVRGCSCFSEW
QGPGCSVPVPANQSFWTREEYSDLKLPRASHKAVVNGNIMWVVGGYMFNHSDYNMVLAYD
LASREWLALNRSVNSVVVRYGHSLALYQDKIYMYGGKIDSTGNVTNELRVFHIHNESWVL
LSPKAKEQYAVVGHSAHIVTLKNGRVVMLVIFGHCPLYGYISSVQEYDLDKNTWSILHTQ
GALVQGGYGHSSVYDDRTKALYIHGGYKAFSANKYRLADDLYRYDVDTQMWTILKDSRFF
RYLHTAVIVSGTMLVFGGNTHNDTSMSHGAKCFSSDFMAYDIDCDRWSVLPRPDLHHDVN
RFGHSAVLYNRTMYVFGGFNSLLLSDILVFTSEQCEAHQSEAACLAAGPGVRCMWDTGSS
QCVSWELAPEAQEKIKSECFSKRIFDHDRCDQLTDCYSCTANTNGCQWCNDHCVPTNHSC
TEGQISIFKYDHCPKDNPMYYCNKKTSCRSCALDQNCQWEPRNQECIALPENICGIGWHL
VGNSCLKITTARETYDNAKLSCRNHNAFLASLTTQKKVEFVLKQLRIMQSSQSMSKFTLT
PWVGLRKINVSYWCWEDMSPFTNSSLQWMPSEPSDAGFCGILSEPSTRGLKAATCINPLN
GSVCERPANHSAKQCRTPCALRTACGECTSGSSECMWCSNMKQCVDSNAYVASFPFGQCM
EWYTMSSCPPENCSGYCTCSHCLEQPGCGWCTDPSNTGKGKCIEGSYKGPVKMPSQGPTG
NSYPQPLLNSSMCLEDSRYNWSFIHCPACQCNGHSKCINQSICEKCENLTTGKHCETCIS
GFYGDPTNGGKCQPCRCNGHASLCNTNTGKCFCTTKGVKGDECQLCEVENRYQGNPLKGT
CYYTLLIDYQFTFSLSQEDDRYYTAINFVATPDEQNRDLDMFINASKNFNLNITWAASFS
AGTQAGEEMPVVSKTNIKEYKDSFSNEKFDFRNHPNITFFVYVSNFTWPIKIQIAFSQHS
NFMDLVQFFVTFFSCFLSLLLVAAVVWKIKQSCWASRRREQLLREMQQMASRPFASVNVA
LETDEEPPDLIGGSIKTVPKPIALEPCFGNKAAVLSVFVRLPRGLGGIPPPGQSGLAVAS
ALVDISQQMPVVYKEKSGAVRNRKQQPPAQPGTCI
Download sequence
Identical sequences Q8MJ16
ENSBTAP00000039639 ENSBTAP00000039639 NP_776420.1.59421 NP_776420.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]