SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039717 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039717
Domain Number 1 Region: 69-103
Classification Level Classification E-value
Superfamily LysM domain 0.0000876
Family LysM domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039717   Gene: ENSBTAG00000027713   Transcript: ENSBTAT00000039933
Sequence length 306
Comment pep:known_by_projection chromosome:UMD3.1:7:92440985:92446470:-1 gene:ENSBTAG00000027713 transcript:ENSBTAT00000039933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRHQNRSFPLPGIHSSAQVHAFGNCADSDMLEEDAEVYELRSRGKEKIRRSTSKDRLD
DIIVLTKDIQEGDTLNAIALQYCCTVADIKRVNNLISDQDFFALRSIKIPVKKFSSLTET
LYPPKGRQASRPSTVQYLPEQQEVLSANDSLSSTESAGSFLKEVDRDIEQIVKCTDTKRE
NLNEVVSALTAQQVRFEPDNKNIQRKDPYYGADWGIGWWTAVVIMLIVGIITPVFYLLYY
EILAKVDVSHHSTVDSSHLHSGVTPPSQQREMENGIAPTKGIPFGPQDDRKLYNQDSQLP
AAQHKT
Download sequence
Identical sequences E1BGG0
9913.ENSBTAP00000039717 NP_001179911.1.59421 NP_001179911.1.76553 XP_005209787.1.76553 XP_019820976.1.53367 ENSBTAP00000039717 ENSBTAP00000039717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]