SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000040019 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000040019
Domain Number 1 Region: 793-1079
Classification Level Classification E-value
Superfamily L domain-like 1.22e-46
Family Internalin LRR domain 0.013
Further Details:      
 
Domain Number 2 Region: 1254-1296,1334-1357
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000167
Family Motor proteins 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000040019   Gene: ENSBTAG00000027900   Transcript: ENSBTAT00000040242
Sequence length 1668
Comment pep:known_by_projection chromosome:UMD3.1:5:14748150:14952308:1 gene:ENSBTAG00000027900 transcript:ENSBTAT00000040242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEGNDDDDIKLSEEIEAELDRISISSLEKYGFDSDSKSETQSDNSDTDSDELPESVLHC
INIIKNKSKTAEELILQDLEDTDVLSCGYGGVSNNHMHLRIELPTECKENPEQLIKMLSE
IEKEEFLRSRTHCGSPDLVLESDLCDLPVDEHVLPDDADINFGYREVEERCRQSFEAWQD
KQKELEDQEKETLKVERDKEEKQFQEEEEKRHCWMKQFEVEKKKLENIQKQEQDKMNDEL
HKEEKIWKERFKQHAEFIRNLHLQMEEERTKFKDLQEKEKMRLSKLQHNAAVKIQAKYKA
FVAYQKYGPIIKEQIESKKKKAQEWKEKEAKIRQIEEEKRKRLEEKQRIEEEIEKQMQEG
RKRREKEYMGKKNILRQEREQLLKMEKLILREATRKQLIISRALKKGEYNAKHLPIEDTS
KNKDVGAKRLGDGKLKMWEDASPWLAEESDKRKNVDRELVLKESVQVQLKESMSSQAILA
VFKVEEKKKNLAVQCSEEFVKQKRNYENRDQKNQLENLHLKEDVREQFQSQELQSQVQKE
EVLKPSINETMRQETQIILGNNQEIDEVKDNESQKIVDDNQQNKMQKVEKEISGQLGTLY
EENNIKEISVISMKQKQVPLKLEKSEHIGENTLLQEEEIDLKSKEAEENPNGSALNSDLV
FNTNDAVINVEGKINKQNYIVDAPCEDLGGYNAKNCLVFKEVNSLKSQIQEIPEECHENT
AECENIVACSIEPTLLSSIEEKRLAWITSFKPWFEIFKQNQQKKIVKRRRIIKCPVNTMP
PLNPLEILRCGPWDTLQQVATITFQDLPGCSLSTLAECPNLQFLSLRRCGLTSLHSLSNC
KRLKYIDAQENHIETINCENLENLCIVLLNKNQLTSLHGLDGCTNIQSLELSHNKITRIG
GLESLKNLQQLIVDHNQLISTTGLCDTPTLMYLDCSHNHLTEVEGIEQCGLLQILKLQGN
YLSELPFLGNHVLLRELHLDDNSISTVETFSSYWLPLLQILTISQNSLTKIAPLFHFVSL
EKLDVSNNCLSDLTSAIKWFDACFSLHELSLTGNPLLQEINWRHSLLKILPALRILNGEM
LTSCTERHTEGHHQLELEHFLEHCQSQIREFNLLSEKYITGDRNIFTLDVAQNLCYYFKK
LMTLSNECRCVHEHGDVSMTRRGESEAQQNHLPPTHSDSKQQNRVLYSSANEYKLNSPDI
SEKWMDSGSSHSSSTNPSLCEDTKERNQEEIVDQKREDSKTSSFPSKRIPFIETVRTRFL
LENCQNTEHHEKIMAAMVIQAYWRGYIVRRQIHFSAKLHPATIGPLTSKPNSCIENQTIL
KKEKVKNTVNIQEQKEKAAILIQAVWKGFLLRKKLTTALEAIKNEESEEEYEEIDLEDFT
FDEAALEKEWLALDSARFPSQTLLLPNQLHWPKFSGILKYDDTSLNLPSHPAQAWLCNEK
ENVLSSEHTQFNSRSENRTLSRLPEAKTSRKSLLKSEKEEKISEEWGFKDISTAQQMLKR
AQKMKSKKLRKKLDPTVRLALFRNNENKVSVIKPPEKAQPQRDGFFEDKEEEFMYKDTTA
NEKLERSKEYTYQWLHTQVGVLETTGSRNMKCKHFLPELDPDVRNGGRVQLVARLVSRED
TDLDLFSMTSGSALSVKTEKKTLAHRHSAGSSSKLWFPSELISKSQMN
Download sequence
Identical sequences E1B933
ENSBTAP00000040019 ENSBTAP00000040019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]