SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000040348 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000040348
Domain Number 1 Region: 144-259
Classification Level Classification E-value
Superfamily C-type lectin-like 7.53e-43
Family Link domain 0.0023
Further Details:      
 
Domain Number 2 Region: 395-553
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-42
Family C-type lectin domain 0.00000564
Further Details:      
 
Domain Number 3 Region: 253-352
Classification Level Classification E-value
Superfamily C-type lectin-like 1.32e-28
Family Link domain 0.0036
Further Details:      
 
Domain Number 4 Region: 29-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000319
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 
Domain Number 5 Region: 350-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000893
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 554-612
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000138
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000040348   Gene: ENSBTAG00000014906   Transcript: ENSBTAT00000042717
Sequence length 656
Comment pep:known_by_projection chromosome:UMD3.1:7:85666058:85782896:1 gene:ENSBTAG00000014906 transcript:ENSBTAT00000042717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLINIKSILWMCSTLIAAHALQKVNMEKSPPVKGSLSGKVNLPCHFSTMPTLPPSYNTTS
EFLRIKWSKIELDKTGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEDVGDASLTMVK
LLASDAGRYRCDVMYGIEDTQDTVSLTVEGVVFHYRAATSRYTLNFEMAQKACVDIGAVI
ATPEQLHAAYEDGFEQCDAGWLSDQTVRYPIRVPREGCYGDMMGKEGVRTYGFRAPHETY
DVYCYVDHLDGDVFHITAPNKFTFEEAGEECKTQDARLATVGELQAAWRNGFDRCDYGWL
LDASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKRPDRCKMNPCLN
GGTCYPTETSYVCTCVPGYSGDRCELDFDECHSNPCRNGATCIDGFNTFRCLCLPSYVGA
LCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVG
HDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSTGEDCVVIIWHENGQWNDVP
CNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCL
GNGRWAMPKITCLNPSAYQRTYSKKYFKNSSSAKDNSINTSKHDHRWSRRWQESRR
Download sequence
Identical sequences F1N6I7
ENSBTAP00000040348 XP_005903818.1.15283 XP_015327844.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]