SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000040728 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000040728
Domain Number 1 Region: 25-477
Classification Level Classification E-value
Superfamily ALDH-like 1.07e-88
Family ALDH-like 0.00000326
Further Details:      
 
Domain Number 2 Region: 515-760
Classification Level Classification E-value
Superfamily ALDH-like 1.7e-41
Family ALDH-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000040728   Gene: ENSBTAG00000000330   Transcript: ENSBTAT00000043139
Sequence length 794
Comment pep:known_by_projection chromosome:UMD3.1:18:56364610:56378365:1 gene:ENSBTAG00000000330 transcript:ENSBTAT00000043139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATRTASRACEIFTTLEYGPAPESHACALAWLDTQDRHLGHYVNGQWLKPEHRSSVPCQ
DPITGENLASCLQAQSEDVAAAVEAARASLENWSTQPGAIRAQHLTRLAKVIQKHQRLLW
TLESLVTGRAVREVRDRDVPLAQQLLQYHAVQAHTQEEALAGWEPMGVIGLILSPTFPFL
DMMWRICPALAVGCTVVVLVPPASPTPLLLAQLAGELGPFPGILNVISGPASLGPVLAAQ
PGVQKVAFCGAIEEGRALRRTLAGWVPELGLALGAESLLLLTEVADVDSAVEGIVDAAWS
DRSPGGLRLLIQEAVWDETMRRLQERMGRLRCGHGLDGAVDMGARGAAARDLAQRYVSEA
QSQGAQVFQAGSEPSDSPFFPPTLVSDLPPASPCTQAEVPWPLVVASPFRTAKEALAVAN
GTPRGGSASVWSERLGQALELAYGLQVGTVWINAHGLRDPAVPMGGCKESGSSWHGGQDQ
PGETPAPVGPPSWGLGMSVTRAPRISLAHPSSSCSPAPPYGLFVGGRFQAPGARSSRPIQ
DSQGSLQGYVAEGGAKDIRGAVEAAHQAAPGWMSQSPAARAALLWALAAALQRREPNLVS
RLERHGVELKVAKAEVELSVKRLRAWGARVQAQGCALQVAELRGPVLRLREPLGVLAIVC
PDEWPLLAFVSLLAPALAHGNTVVLVPSGACPIPALEVCQEMATLLPAGLVNVVTGDRDH
LTRCLALHQDIQALWYFGSAQGSQFVEWASAGNLKPVWVNRGCPRAWDQEAEGAGPELGR
RAARTKALWLPMGD
Download sequence
Identical sequences F1N441
ENSBTAP00000040728 ENSBTAP00000040728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]