SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000040809 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000040809
Domain Number 1 Region: 397-529
Classification Level Classification E-value
Superfamily CalX-like 7.46e-34
Family CalX-beta domain 0.00000389
Further Details:      
 
Domain Number 2 Region: 529-681
Classification Level Classification E-value
Superfamily CalX-like 8.37e-31
Family CalX-beta domain 0.00000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000040809   Gene: ENSBTAG00000027080   Transcript: ENSBTAT00000022798
Sequence length 927
Comment pep:known_by_projection chromosome:UMD3.1:10:82128379:82273227:-1 gene:ENSBTAG00000027080 transcript:ENSBTAT00000022798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWLRLQPLTSAFLHFGLITFVLFLNGLRAEAGGSGDVPSTGQNNESCTGSSDCKEGVIL
PIWYPENPSLGDKIARVIVYFVALIYMFLGVSIIADRFMASIEVITSQEREVTIKKPNGE
TSTTTIRVWNETVSNLTLMALGSSAPEILLSLIEVCGHGFIAGDLGPSTIVGSAAFNMFI
IIGICVYVIPDGETRKIKHLRVFFVTAAWSIFAYIWLYMILAVFSPGVVQVWEGLLTLFF
FPVCVLLAWVADKRLLFYKYMHKKYRTDKHRGIIIETEGDHPKGIEMDGKMMNSHFLDGH
LVPLEGKEVDESRREMIRILKDLKQKHPEKDLDQLVEMANYYALSHQQKSRAFYRIQATR
MMTGAGNILKKHAAEQAKKTSSMSEVHADEPEDFVSKVFFDPCSYQCLENCGAVLLTVVR
KGGDTSKTLYVDYKTEDGSANAGADYEFTEGTVVLKPGETQKEFSVGIIDDDIFEEDEHF
FVRLSNVRMEEEQPEEGMSPRALNSPPLPRAVLVSPCVATVTILDDDHAGIFTFECDTIH
VSESIGVMEVKVLRTSGARGTVIVPFRTVEGTAKGGGEDFEDIYGELEFKNDETVKTVRV
KIVDEEEYERQENFFIVLGEPKWMERGISALLLSTEVTDRKLTVEEEEAKRIAEMGKPIL
GEHPKLEVIIEESYEFKTTVDKLIRKTNLALVVGTHSWRDQFMEAITVSAAGDEDEDESG
EERLPSCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFVVSILIIGMLTAIIGDLASHFG
CTIGLKDSVTAVIFVAFGTSVPDTFASKAAAIQDVYADASIGNVTGSNAVNVFLGIGLAW
SVAAIYWALQGQEFHVSAGTLAFSVTLFTIFAFVCISVLLYRRRPHLGGELGGPRGCKLA
TTWLFVSLWLLYILFATLEAYCYIKGF
Download sequence
Identical sequences E1BM32
NP_001178128.1.59421 NP_001178128.1.76553 XP_005905815.1.15283 XP_010807805.1.76553 XP_019824698.1.53367 9913.ENSBTAP00000040809 ENSBTAP00000040809 ENSBTAP00000040809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]