SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000040841 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000040841
Domain Number 1 Region: 76-113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000471
Family LDL receptor-like module 0.0037
Further Details:      
 
Domain Number 2 Region: 163-204
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000183
Family LDL receptor-like module 0.0036
Further Details:      
 
Domain Number 3 Region: 128-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000877
Family LDL receptor-like module 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000040841   Gene: ENSBTAG00000024195   Transcript: ENSBTAT00000043254
Sequence length 206
Comment pep:known_by_projection chromosome:UMD3.1:3:92779834:92789221:1 gene:ENSBTAG00000024195 transcript:ENSBTAT00000043254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKIFPQGDANGSAAAGSKALPGGEANCSPCCCSRRGACLSAFLMLLLTALAALIALVAI
LGPPPRTPGAQACVTQTNRTGFLCDDRSSCIPASSVCDGVRACAHGEDEEEALCRGVPQS
LPGFLVAHCGDPASWIYSDQMCDGINNCGDCSDELSPVTTCPPCGPGWWRCPSTVFRYCS
CIPRSLCWDHVQHCFDWSDEYSCPGP
Download sequence
Identical sequences E1BLZ7
NP_001178127.1.59421 NP_001178127.1.76553 9913.ENSBTAP00000040841 ENSBTAP00000040841 ENSBTAP00000040841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]