SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000040907 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000040907
Domain Number 1 Region: 57-328
Classification Level Classification E-value
Superfamily L domain-like 1.02e-58
Family Ngr ectodomain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 362-455
Classification Level Classification E-value
Superfamily Immunoglobulin 8.02e-20
Family I set domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000040907   Gene: ENSBTAG00000006841   Transcript: ENSBTAT00000043330
Sequence length 711
Comment pep:known_by_projection chromosome:UMD3.1:18:57103010:57127435:-1 gene:ENSBTAG00000006841 transcript:ENSBTAT00000043330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARARGSLCPPLPPGRMSWPHGALLFLWLFSPPLGAGGGGMAVTSAAGGGAPPATSCPAA
CSCSNQASRVICTRRELAEVPASIPVNTRYLNLQENGIQVIRTDTFKHLRHLEILQLSKN
LVRKIEVGAFNGLPSLNTLELFDNRLTTVPTQAFEYLSKLRELWLRNNPIESIPSYAFNR
VPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEELELSGNR
LDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHDLFTPL
HRLERVHLNHNPWHCNCDVLWLSWWLKETVPSNTTCCARCHAPAGLKGRYIGELDQSHFT
CYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGSYRVRISVLHDGT
LNFTNVTVQDTGQYTCMVTNSAGNTTASATLNVSAVDPVAAGSAGSAGGGGGGGPGGGGG
GYTYFTTVTVETLETQPGEEALQPRGTEKEPPGPTTDGVWGGGRPGEGAGQASSSTTAPA
PRSSRPTEKAFTVPITDVTENALKDLDDVMKTTKIIIGCFVAITFMAAVMLVAFYKLRRQ
HQLHKHHGPTRTVEIINVEDELPAASAVSVAAAAAVAGGGGVGGDSHLALPALERDHLNH
HHYVAAAFKAHYSSNPSGGGCGGKGPPGLNSIHEPLLFKSGSKENVQETQI
Download sequence
Identical sequences E1BPK8
ENSBTAP00000040907 NP_001179210.1.59421 NP_001179210.1.76553 XP_005219384.1.76553 ENSBTAP00000040907 9913.ENSBTAP00000040907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]