SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000040914 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000040914
Domain Number 1 Region: 421-613
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.94e-18
Family Laminin G-like module 0.02
Further Details:      
 
Domain Number 2 Region: 830-1028
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-17
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 3 Region: 628-783
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.88e-17
Family Laminin G-like module 0.025
Further Details:      
 
Domain Number 4 Region: 111-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000113
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 5 Region: 323-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000511
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 6 Region: 149-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000134
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 7 Region: 227-268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000273
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 8 Region: 187-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000493
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 9 Region: 1172-1209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000931
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 10 Region: 1057-1093
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000113
Family EGF-type module 0.008
Further Details:      
 
Domain Number 11 Region: 73-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000205
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 12 Region: 361-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000306
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 13 Region: 1094-1132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000203
Family EGF-type module 0.015
Further Details:      
 
Domain Number 14 Region: 265-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000902
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000040914   Gene: ENSBTAG00000014391   Transcript: ENSBTAT00000043337
Sequence length 1281
Comment pep:known_by_projection chromosome:UMD3.1:11:94501988:94523379:1 gene:ENSBTAG00000014391 transcript:ENSBTAT00000043337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAWPGTRDPRPSAHLLLLLLLLHRAPVLALPAGTVPSETPGACASDPCAPGTKCQATE
NAGYSCVPLEPRGCASQPCHHGALCVPQGPGPDDFRCYCVPGFQGPHCELDIDECASRPC
HHGATCRNLADRYECHCPLGYEGVTCETEVDECASAPCLHGGSCLDGVGSYRCVCAPGYG
GASCQLDLDECQSQPCAHGGVCRDLVNGFRCDCADTGYEGERCELEVLECASAPCANNAS
CLEGLGSFRCLCWPGYSGERCEVDEDECAVGPCQHGGQCLQRSDPTLYGGIQATFPDDFS
FRQAAGFVCRCPPGFEGDDCGEDVDECASRPCLSGGLCQDLPNGFHCHCPDGYTGPTCQE
DMDECLSEPCLHGGTCEDTVAGYICGCPEAWGGLDCSVPLTGCQGHTCPPTATCVPTFES
GVHSYTCRCPPGTHGPFCGQNTTFSMVAGNPLRASVPAGSSLGLALRFRTTIRVGALATC
SDTQGSVELALVEARLQATLWSHGKNVLVLRLLEPPLNDGHWHRVEVTLRLGVLELRLWH
EDCPAHLCVASSPMATAAPAPTPAGSRFTQLGGVAFAGCLQDVQVDGHLLLPEDLGENVL
LGCWHQEHCQPPPCAHGGVCVDLWTHFHCDCPRPYRGPTCADEVPAATFGLGGTLSSASF
LLDQPPGPNLTVSFLLRTREPAGLLLQLTNGSAAGLTVFLSEGQIWAEALGSPALVLPGR
WDDGLRHLVTLSFGPDQLWGVGQQVHVGGRLLPGDAEPWGGPFRGCMQDVRLNDLHLPFF
PPLLGNSSLPSVPGRGQSWNLTMGCISEDTCNPEPCLNGGTCLVTWNDFHCTCPANFTGP
TCAQQLWCPGQPCLPPATCEEVPDGFVCVAEATFREGPPAEFSGHNASSGSALSGLSLVF
RTRDPEAGLLRAEDGPAAVWLAVRNGSLAAGVRSGAGLPRAVLPAPGPRVADGAWHRVRL
AMEQPAAVASRWLLWLDGAATPVSLRGLAGDLDFLRGPGAARVLLAENFTGCLGRVALGG
HPLPLARPRPGAAPGSREPFSARPGAPAPHLGCSGAPVCVPSPCLHGGACRDLFDAFACA
CGPGWEGPRCEDRADPCRSAPCARGRCHAHPDGHFECRCPPGFAGPRCRLPVPPEGCSLN
ITCLNGGQCEEGPQGANCSCQESFAGQRCQIPCEANPCLNGGTCRAADGVYECVCNARFS
GQFCEVVKGLPLPLPFPLLEVAVPAACACLLLLLLGLLSGILAARKRRQSEGTYSPSQQE
VAGARLEMDSVLKVPPEERLI
Download sequence
Identical sequences F1N2V0
ENSBTAP00000040914 ENSBTAP00000040914 XP_003586718.1.76553 XP_015320971.1.59421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]