SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041148 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041148
Domain Number 1 Region: 716-801
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000102
Family Fibronectin type III 0.0045
Further Details:      
 
Domain Number 2 Region: 114-158
Classification Level Classification E-value
Superfamily Elafin-like 0.000000017
Family Elafin-like 0.0015
Further Details:      
 
Domain Number 3 Region: 904-943
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000778
Family EGF-type module 0.019
Further Details:      
 
Domain Number 4 Region: 495-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000802
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041148   Gene: ENSBTAG00000021270   Transcript: ENSBTAT00000043589
Sequence length 1333
Comment pep:known_by_projection chromosome:UMD3.1:1:143829672:143904907:1 gene:ENSBTAG00000021270 transcript:ENSBTAT00000043589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMLRTLGMALLALLIIVNPSQASGFTEKGLSLLGFRLCNYSVTQSVQSVKAVQMSRLTRV
PCGGWIPLWRCPKTVYQTRYLEVEVPEPRNVTDCCEGYEQLGLYCVLPLNRSQEFASRPG
SCPVVGLETSALLCTLDAECPGLQKCCPSSGGHRCSAPAAPAPESNREACWYNVTVVVKM
DFKELQQVDPRLLDHMRLLHSMVTSALQPLDTTVHHLHSARGDTSTTVSWLLLGLPRPMP
VARVSAVLDGMVKRIYEVIDVQVQDVNECSYGELNTCSGRELCLNVEGSHQCVHSCSLGR
TTADYPPIRDLMILNVTSSSFQVSWSLNSTQNHTFWVKVYQGEELFRSASTPGTSLEVAR
AGAGVRYGVKTSYQACGATSLPWSLPGPKKDARVFEVVVRILNHSVTEELLDRGSPECQD
FSQQLMHEVAASLPPAISDLYRRGKLRLQVVSLQSGSVVVRLRLTVWDSEFPVGVSTLAP
LLPALWASTVFQVDQQGTRVQDWDECADSLEHDCSPAAQCINLEGSYTCRCRTARDANPS
RPGRVCHGDMESPTDVPSPVSEVTASVPSTETTSFSLETPALSPGPGHLWSTPAAGQAWT
LGLPPRRGVSGLGSHSGNSTGQVPGPTHSSSLGATDSLPDTPGQSPPNSTEELPFWPTPA
PDPRGHIEWHSSLPVRDTPPAPLDPTWAQNLDPRPFSSPDQPLAPTPAPLKTPACAPVPI
GRVTVSNVTSTGFHVAWVADPTLRPTFQLSLVSARSPTMHLQTQKASLTLSGLEPGVLYL
VEIVARACGQESAKAQLKVRTVAQKLSGKVRIVNVRYLESFSNTSSEQFQAFLELFLRTV
RNSLPAFMLQHLDTGGVRIEVTGISNGSVVVEFTLLVITDVDVWEVSAAFLAAFRNTSLL
EVVRDDTFIGDYDECASQEDDCAPGSACRNTLGSFTCSCEGGAPDLLVEFSGRPCEGDSP
GNTTQPPGPEQPPTPTGAGAASGQDARPATQGLSPRLNLTGAVRVLCEIEKVAIVIQRHF
LQQKGIPESSLYLGQPSCNISDRNSTHVTLAATWSECGTTLQSNMTTTVVRTTLRNDVSP
EGIIHHMKIESPIHCAFQNDLLTSSGYTPEWGVYTIIEDLHGAGSFITEMQLFIGDSPIP
QNYSVSASDDVKIEVGLYKQKSNLKVVLTECWATPSSDARDPVMFGFINNSCPIPNTHTN
VIENGNSNKARFKLKIFSFINNSIVYLHCKLRICMESPGATCKINCDDFRSLRSSEPSVM
HQMSWGPLIRSEAGSPLAAGLGLGAGYLVLIVGTACALVAGATALLVRHYQRMIGKYDFK
VRTDNFSYQVFHE
Download sequence
Identical sequences F1MN54
ENSBTAP00000041148 ENSBTAP00000041148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]