SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041245 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041245
Domain Number 1 Region: 285-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000105
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 2 Region: 384-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000023
Family Laminin-type module 0.0043
Further Details:      
 
Domain Number 3 Region: 238-287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000787
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 188-230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000153
Family Laminin-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041245   Gene: ENSBTAG00000013706   Transcript: ENSBTAT00000043692
Sequence length 586
Comment pep:known_by_projection chromosome:UMD3.1:8:111919130:111995270:-1 gene:ENSBTAG00000013706 transcript:ENSBTAT00000043692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAASATSAGNVTGGGGAAGQVDASPGPRLGGEPSHPFSKATAPTAQAPRTGSPRATLHRP
QAASSSAQPPETTPPPTTAGPAPTTAAGPARTTSQAPLVPSRVTPPAVERTPTTPWVTTR
PAPTTLSTTTGPAPTTPVATTVRAPTAPPNPTSALPGGGGGGGSSSSSVPPTPPATEAPS
PPPPEYVCNCSAVGSLGVNRCNQTTGQCECQPGYQGLRCETCTEGFYLNGTSGRCLPCDC
NPRGALSTVCSSSGKCQCKVGVTGSSCDRCQDGYYDFNENGCLPCQCNNRSASCDALTGA
CFNCQDNSEGDHCEECTEGFYQSPDGSKECLRCPCSAVTSTGSCIIKLGESEPECVQCKD
GYTGQNCNDCNHGYYNSDSICVECQCHGHVDPVKTPRVCEPESGECISCLHNTTGFWCEN
CLDGYDRDLEGNCITKEVIVPTPEGSTILVSNASLTTSVPTPVINSTFTPTTPQTIFSVS
SAENSTSALADVSWTQFNIIILTVIIIVVVLLMGFVGAVYMYREYQNRKLNAPFWTIELK
EDNISFSSYHDSIPNADVSGLLEDDGNEVAPNGQLTLTTPMHNYKA
Download sequence
Identical sequences F1MLU6
ENSBTAP00000041245 ENSBTAP00000041245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]