SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041246 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041246
Domain Number 1 Region: 414-901
Classification Level Classification E-value
Superfamily ALDH-like 3.67e-164
Family ALDH-like 0.000000000809
Further Details:      
 
Domain Number 2 Region: 1-201
Classification Level Classification E-value
Superfamily Formyltransferase 1.7e-51
Family Formyltransferase 0.00000000353
Further Details:      
 
Domain Number 3 Region: 205-306
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.02e-25
Family Post formyltransferase domain 0.00000193
Further Details:      
 
Domain Number 4 Region: 325-413
Classification Level Classification E-value
Superfamily ACP-like 0.00000173
Family Acyl-carrier protein (ACP) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041246   Gene: ENSBTAG00000014470   Transcript: ENSBTAT00000043693
Sequence length 902
Comment pep:known chromosome:UMD3.1:22:61221251:61248521:-1 gene:ENSBTAG00000014470 transcript:ENSBTAT00000043693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIAVIGQSLFGQEVYCRLREEGHEVVGVFTVPDKDGKADPLGLQAEQDGVPVFKFPRWR
AKGRALPDVVAQYQALGAELNVLPFCSQFIPMEVISAPRHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFTIFWADDGLDTGDLLLQKECEVLPDDTVSSLYNRFLFPEGVKGMVQAV
KLIAEGKAPRLPQPEEGATYEGIQRKETARIDWDQPAEAIHNWIRGNDKVPGAWTEACGQ
KLTFFNSTLSTAGLEPEGEDLPIPGAHRPGVITKAGLILFGNDGRMLLVKNIQLEDGKMI
PAAHFFEKVESSALELTEEELGTAEAVRGAWKRILPSVPEVDESTDFFKSGAASVDVVRL
VEEVKELCDGLELENEDVYMATTFGDFIQLLVRRLRGGDKETECAIDYVEKAVNKLTLRM
PHQLFIGGTFVDAEGGKTYETINPTDGSALCQVSLAQVSDVDKAVAAAKDAFEIGGWGKI
SARDRGRLLYRLAELMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKI
QGSTIPINQARPNRNLTMTRREPIGVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKPAQ
VTPLTALKFAELTLKAGIPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMK
SCALSNVKKVSLELGGKSPLLIFADCDLGKAVQMGMSSVFFNKGENCIAAGRLFVEDSIH
DQFVRRVVEEVGKMKIGNPLDRDTNHGPQNHLAHLQKLLEYCQRGVEEGATLVCGGKQVP
RPGFFFEPTVFTDVQDHMFIAREESFGPIMIISRFADGDVDAVLTRANATEFGLASGVFT
RDINKALYVSDKLEAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTF
EY
Download sequence
Identical sequences E1BMG9
ENSBTAP00000041246 ENSBTAP00000041246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]