SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041298 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041298
Domain Number 1 Region: 130-261
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.03e-46
Family Galectin (animal S-lectin) 0.00000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041298   Gene: ENSBTAG00000002326   Transcript: ENSBTAT00000043753
Sequence length 265
Comment pep:known chromosome:UMD3.1:10:67843328:67861113:1 gene:ENSBTAG00000002326 transcript:ENSBTAT00000043753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGFSLNDALSGSGKPNPQGWPGSWGNQPAGAGGYPGAAYPGAYPGQAPPGPYPGQGPP
GAYPGQGPPGAYPGQGPPGAYPGPTAPAYPGPTAPSAYPGPGAYPPPAQPSAPGAYPAAG
PYGIPSGPLNVPYDLPFPGGIRPRMLITILGTVKPNANRLALDFKRGNDVAFHFNPRFNE
DNRRVIVCNSKLNNNWGKEERQMVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRV
KNFGEISTLGISGDITLTSASHTMI
Download sequence
Identical sequences A6QLZ0
9913.ENSBTAP00000041298 NP_001095811.1.59421 NP_001095811.1.76553 XP_005905109.1.15283 XP_019824517.1.53367 ENSBTAP00000041298 ENSBTAP00000041298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]