SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041372 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041372
Domain Number 1 Region: 141-212
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000208
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 2 Region: 201-261
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000122
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 3 Region: 88-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000141
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 4 Region: 5-122
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000424
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 5 Region: 483-588
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000476
Family Fibronectin type III 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041372   Gene: ENSBTAG00000004813   Transcript: ENSBTAT00000043830
Sequence length 713
Comment pep:known_by_projection chromosome:UMD3.1:8:103170080:103284200:-1 gene:ENSBTAG00000004813 transcript:ENSBTAT00000043830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DICATCHEHATCLKRETTSICICKYGFVGNGRTHCIDKDECQYGASVVCGNHTSCHNIPG
GFYCICLEGYRATNNNKTFIPNDGTFCTDIDECEVSSRCRRGGRCVNTRGSYECYCMDGY
LPKGGPEPFHPTRDATSCTEIDCGTPPEIPGGYIIGNYTSRLGSQVHYACKEGFFSDSED
TASSCTAMGTWESPKLNCQEIDCGRPPEVQHAILEGNHSSRLGSVAHYVCLEGFESPGGK
ITSVCTEKGTWRTSASTCSEIIIEINEVSVFNNTCVRWQINPGRINSKIEYVIYIKGQRL
DPLESGHEETVNLTTESRTPEVCLDLYPGTNYTVNISTAPPRRSVPAVTEFQTAGDDLLE
DDGIFNISIFNEVCLKLNRHSRKVGSERVYQFKVLGRRWYLNTFYHATSFNFTTREQTAV
VCLDLYPATDYSVNVTLLGSPERPSVQTTVTTAPAVKQTISNISVFNETCLRWRSMKTAD
IEEMYLVHIWGQRWYQKGFAQEMIFNITASSQTPETCLDLSPGTNYSVSIQALSSELPVV
ISLTTQITEPPLPEVDFFTVHGGPLPRLRLRKATEKNGPISSYQVLVLPSALQSTFACDS
EEVASFFSEASEASGYVTAELLAKDIPDDAMEIPIGDRLYYGKYYNAPLKTGHDYCIILR
ITSEWNEVRRSACAVWAHVKGSSLTFLLPQMVGVGLGSMAVVIVLAFLSFSAV
Download sequence
Identical sequences F1MQ74
ENSBTAP00000041372 ENSBTAP00000041372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]