SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041399 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041399
Domain Number 1 Region: 1505-1800
Classification Level Classification E-value
Superfamily Kelch motif 1.83e-41
Family Kelch motif 0.014
Further Details:      
 
Domain Number 2 Region: 211-497
Classification Level Classification E-value
Superfamily Kelch motif 4.45e-37
Family Kelch motif 0.0088
Further Details:      
 
Domain Number 3 Region: 36-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-23
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 4 Region: 1194-1242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000046
Family Laminin-type module 0.0098
Further Details:      
 
Domain Number 5 Region: 1057-1092
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000239
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 1146-1194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000176
Family Laminin-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041399   Gene: ENSBTAG00000031001   Transcript: ENSBTAT00000043858
Sequence length 2772
Comment pep:known_by_projection chromosome:UMD3.1:18:51247602:51291960:-1 gene:ENSBTAG00000031001 transcript:ENSBTAT00000043858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGRALAVALAVSLAVLGPLSPGAQAGDCKGQRQVLREAPGFVTDGAGNYSVNGNCEWL
IEAPSSQHRILLDFLFLDTECTYDYLFVYDGDSPRGPLLASLSGSTRPPPIEASSGKMLL
HLFSDANYNLLGFNASFRFSLCPGGCRSHGQCQPPGVCVCEPGWGGPDCSLQECSAYCGS
HGTCTSPLGPCRCEPGFLGRACDLHLWENQGAGWWHNVSAGDPAFSARIGAAGAFLSPLG
LLAVFGGQDLNRALGDLVLYNFSANTWERWDLSPAPAARHSHVAVAWAGSLVLMGGELAD
GTLTSDIWAFSPMGGGRWELLAPPASSPSGPPGLAGHAAALVDNTWLYVSGGRTQHDLFS
SGLFRFRLDGTSGGYWEQVMPAGGRPPAATGHSMVFHAASRALLVHGGHRPSTARFSVRV
NSTELFHVDRRVWTTLKGREGLHGPRERAFHTASVLGNYMLVYGGNVHTHYQEEKCYEDG
IFFYHLGCHQWVSGAELAPPGTPEGRAAPPSGRYSHVAAVLGGSVLLVAGGYSGRPRGDL
MAYKVPPFVFQAPAPDYHLDYCSMYTDHSVCSRDPECSWCQGACQAAPPPGTPSGACPAA
SCLGLSRLLGDCQACLAFSSSAAPPQGPGALGWCVHNESCLPRPGGGAARAGPGLSYCVW
VVSATEVLQPCAPGTLCPPLTLTFSPDSSTPCTTDPGPHVPPNSIPQAPTPLFLSPQTLP
LPRLPPVSWTPVSHSPVQRETEEKHKDQKKENRREDERKQVTETGKELGGRRERERRVRR
LGAGRARGHGGTGSGRSPAPHTPSHALSLSPAELTGCRVGGTLPDSSGRPDPGRAGCTPR
PPCGWCSDATHRRGPGRTEEEEPRGSPSLPPASLVPELAPAPTEAQGDGRAADDQDLCRP
SRGGELEDFSARPRASQASPATAEPKRPSNLISSSVLLNGSLSLCCKMNQTFFLKKIHLK
KMRNLKTRPFDTLCWAPHPGFPTLSGWEALGGCWKVSRCRPVCPSTPIAFFNPTPRSCLQ
GDFSGPLSGGNCSLWVGEGLGLSVALPARWAYARCPDVDECRLGLARCHLRATCLNTPLS
YECHCQRGYQGDGVTYCNRTCLEDCGHGVCSGPPDFTCVCDLGWTSDLPLPTPAPGPPAP
RCSRDCGCNFHSHCHKRGPGFCDECQDWTWGEHCERCRPGSFGNATGSGGCRPCQCNGHG
DPRRGHCDNLSGLCFCQDHTEGAHCQLCSPGYYGDPRAGGSCFRECGGRALLTNVSSVAL
GSRRFGGLLPAGGGAARAGPGLSYCVWVVSATEVLQPCAPGTLCPPLTLTFSPDSSTPCT
LSYVLAFDGFPRFLDTGVVQSDRSLIAAFCGQRRDRPLTVQALSGLLVLHWEANGSSSWG
FNASVGSARCGSGGPGSCPVPQECVPQDGVPGAGLCRCPQGWAGPHCRMAVCPENCNAHN
GAGTCNQSLGVCVCAEGFGGPDCATKLDGGQLVWETLMDSRLSADTASRFLHRLGHTMVE
GPDATLWMFGGLGLPQGLLGNLYRYSVSERRWTQMLAGAEDGGPGPSPRSFHSAAYVPAG
RGAMYLLGGLTAGGIARDFWVLNLTTLQWRQEKAPQTVELPAVAGHTLTARRGLSLLLVG
GYSPENGFNQQLLEYQLATGTWVSGAQSGTPPTGLYGHSAVYHEATDSLYVFGGFRFHVE
LAAPSPELYSLHCPDRTWSLLAPSQGAKPRPRLFHASALLGDTMVVLGGRSDPDEFSSDV
LLYQVNCNTWLLPDLIGPASVGPPMEESVAHAVAAVGGHLFISGGFGGVALGRLLALTLP
PDPCRLLPSPEACNQTGACTWCHGACLSGDQAHRLGCGGTPCSPMPHSPEECRRLRTCSE
CLARHPRTLQPGDGEASAPRCKWCTNCPEGACIGRNGSCTSENDCRINQREVFWAGNCSE
AVCGAADCEQCTREGKCMWTRQFKRTGETRRILSVQPTYDWTCFSHSLLNVSPMPVESSP
PLPCPTPCHLLPNCTSCLDSKGADGGWQHCVWSSSLQQCLSPSYLPLRCMAGGCGRLLRG
PESCSLGCAQATQCALCLRRPHCGWCTWGGQDGGGRCLEGGLSGPRDGLTCGRPGASWAF
LSCPPEDECANGHHDCNETQNCHDRPHGYECSCKAGYTMDNVTGLCRPVCAQGCVNGSCV
EPDHCRCHFGFVGRNCSTECRCNRHSDCAGVGARDHCLLCHNHTKGSHCEQCLPLFVGSA
VGGGTCRPCHAFCRGNSHVCVSRKELEIARREPEKYSLDPDEIEHWATEGPSEDEAVCVN
CQNNSYGDKCESCLHGYFLLDGKCTKCQCNGHADTCNEQDGTGCPCQNNTETGTCQGSSP
SDRRDCYKYQCAKCRESFHGSPLGGQQCYRLISVEQEYCLDPTSQTNCFHEPKRRALGPG
RTVLFGVQPKFTNVDIRLTLDVTFGAVDLYVSTSYDTFVVRVAPDTGVHTVHIQPPPPPP
PPPPPADGGPRGPGDLGGPGAGGGPATPAEPRVREVWPRGLITYVTVTEPSAVLVVRGVR
DRLVITYPHEHHTLKSSRFYLLLLGVGDPSGPSANGSADSQGLLFFRQDQAHIDLFVFFS
VFFSCFFLFLSLCVLLWKAKQALDHRQEQRRHLQEMTKMASRPFAKVTVCFPPDPAAPAP
TWKPAGLPPPAFRRSEPFLAPLLLTGAGGPWGPVGGGCCPPAIPTTTAGLRAGPITLEPT
EDGMAGVATLLLQLPGGPHAPNGACLGSALVTLRHRLHEYCGGGGGAGGSGHGAGAGRKG
LLSQDNLTSMSL
Download sequence
Identical sequences E1BPS6
ENSBTAP00000041399 ENSBTAP00000041399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]