SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041521 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041521
Domain Number 1 Region: 433-689
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-61
Family YWTD domain 0.000000943
Further Details:      
 
Domain Number 2 Region: 1347-1604
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-57
Family YWTD domain 0.00000335
Further Details:      
 
Domain Number 3 Region: 735-991
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-55
Family YWTD domain 0.00000153
Further Details:      
 
Domain Number 4 Region: 1042-1295
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-47
Family YWTD domain 0.00000306
Further Details:      
 
Domain Number 5 Region: 346-425,681-728
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000643
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 6 Region: 256-296
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000275
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 7 Region: 220-258
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 8 Region: 135-175
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00062
Further Details:      
 
Domain Number 9 Region: 1301-1346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000461
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 10 Region: 301-337
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 11 Region: 61-98
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000681
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 12 Region: 97-134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 13 Region: 179-217
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000707
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 14 Region: 997-1050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000154
Family EGF-type module 0.013
Further Details:      
 
Domain Number 15 Region: 18-59
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000288
Family LDL receptor-like module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041521   Gene: ENSBTAG00000008429   Transcript: ENSBTAT00000043997
Sequence length 1897
Comment pep:known chromosome:UMD3.1:15:77663792:77701236:-1 gene:ENSBTAG00000008429 transcript:ENSBTAT00000043997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTGSSFLCPGLASSPECACGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDHSDEDGCKL
PTCSPLDFHCDNGKCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFPCQNGYCIRSLWH
CDGDNDCGDNSDEQCDMRKCSDKEFRCSDGSCIAEHWYCDGDTDCKDGSDEESCPSAVPA
PPCNLEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDSGLCINAGW
RCDGDADCDDQSDERNCTTSVCTAEQFRCRSGRCVRLSWRCDGEDDCADNSDEENCENTG
SPQCASDQFLCWNGRCIGQRKLCNGVNDCGDNSDESPQQNCRPRTGEENCSVNNGGCAQK
CQMVRGAIQCTCHTGYRLTEDGRTCQDVNECAEEGYCSQGCTNSEGAFQCWCEAGYELRP
DRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHRRELVFWSDVT
LDRILRANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVL
LWQNLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDYA
GRRMYWVDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANK
FTGKNQEIIRNKLHFPMDIHTLHPQRQPAGKNRCGDNNGGCTHLCLPSGQNYTCACPTGF
RKISSHACAQSLDKFLLFARRMDIRRISFDTEDLSDDVIPLADVRSAVALDWDSRDDHVY
WTDVSTDTISRAKWDGTGQEVVVDTSLESPAGLAIDWATNKLYWTDAGTDRIEVANTDGS
MRTVLLWENLDRPRDIVVEPMGGYMYWTDWGASPKIERAGMDASGRQVIISSNLTWPNGL
AIDYGSQRLYWADAGMKTIEFAGLDGSKRKVLIGSQLPHPFGLTLYGERIYWTDWQTKSI
QSADRLTGLDRETLQENLENLMDIHVFHRRRPPVSTPCATENGGCSHLCLRSPNPSGFSC
TCPTGINVMPDGKTCSPGMNSFLIFARRIDIRMVSLDIPYFADVVVPINITMKNTIAIGV
DPQEGRVYWSDSTLHRISRARLDGSQHEDLITTGLQTTDGLAVDAIGRKVYWTDMGTNRI
EVGNLDGSMRKVLVWQNLDSPRAIVLYHEMGFMYWTDWGEHAKLERSGMDGSDRAVLINS
NLGWPNGLTVDKASSQLLWADAHTERIEAADLNGANRHTLVSPVQHPYGLTLLDAYIYWT
DWQTRSIHRADKGTGSNVILVRSNLPGLMDIQAVDRSQPLGVNKCGPRNGGCSHLCLPRP
SGFSCACPTGIQLKGDGKTCDPAPETYLLFSSRGSIRRISLDTSDHTDVHVPVPELNNVI
SLDYDSVDGKVYYTDVFLDVIRRADLNGSNMETVIGRGLKTTDGLAVDWVARNLYWTDTG
RNTIEASRLDGSCRKVLINNSLDEPRAIAVFPRKGYLFWTDWGHIAKIERANLDGSERKV
LINTDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLSGKLRQVLVSHVSHPFALTQQDRW
IYWTDWQTKSIQRVDKYSGRNKETVLANVEGLMDIIVVSPQRQTGTNACGVNNGGCTHLC
FARTSDFVCACPDEPDGRPCSLVPGLVPPAPRATSMSDRSPVLPNTLPTTLRSSTTRTRT
SLEEVEGRCSEKDARLGLCAHSNEAVPAAPGEGLHASYIIGGLLSVLLILVVIAALMLYR
HKKSKLTDPGMGNLTYSNPSYRTSTQEVKIEATPKPAMYNQLCYKKEGGPDHNYTKEKVK
IVEGICLLSGDDAEWDDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDMETEQLLQE
EQSECSSVHTAATPERRGSLPDTGWRHERKLSSESQV
Download sequence
Identical sequences F1ML31
ENSBTAP00000041521 ENSBTAP00000041521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]