SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041534 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041534
Domain Number 1 Region: 146-308
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-27
Family MAM domain 0.0093
Further Details:      
 
Domain Number 2 Region: 1856-1919
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000818
Family ATI-like 0.037
Further Details:      
 
Domain Number 3 Region: 1077-1137
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000131
Family BSTI 0.03
Further Details:      
 
Domain Number 4 Region: 29-140
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000586
Family MAM domain 0.0065
Further Details:      
 
Domain Number 5 Region: 1464-1524
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000278
Family BSTI 0.07
Further Details:      
 
Domain Number 6 Region: 2381-2414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000903
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 7 Region: 2265-2324
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000126
Family BSTI 0.043
Further Details:      
 
Domain Number 8 Region: 697-751
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000605
Family ATI-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041534   Gene: ENSBTAG00000003432   Transcript: ENSBTAT00000044014
Sequence length 2489
Comment pep:known_by_projection chromosome:UMD3.1:25:36366140:36396646:-1 gene:ENSBTAG00000003432 transcript:ENSBTAT00000044014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLKLPRARLPAPAAPSPGSLSTLLIFSSPDGYYMLLDPKNAKASQKSVLLSPLIQSSGCL
SLSFHYLLRGRSPGAGFTAYASVLGSIRKHTIFSGQPGPNWQPVSVNYTGQGQIQFTLMG
VFAKIPEPAVAVDAISIAPCGESFPQCDFEDKDHPFCDWVQVLQDGGRWTQGSANTLIHG
TGPFGIALSGESHFVYLEANKFSQEGQSYKLVSRPFCAPGAICVAFTYHMDGRGKGTKLR
LLLGSPAGSPPSSLWERVGSQGPDWLNDSMTIPSGHQQPMQLMFEVERGSHAAFVVALGF
IFIGQGTCQETSTTSSEISPVPTEKPVAATEKPTVPSETPTVPTEKPVVTAEKLTVPTKR
PTVPTEKPTVPTEKTTIPAKKTTILTEKPTILTEEPTFLPEWPLFPSEWPPVPTEKPIVS
TERTTIPTEKTTIPTEKPMVPTEKTTIPTEKATVPTEKTTIPTEKTTIPTEKVTVPTEKT
TIPTEKTTVPTEKTTIPTEKTTIPIEKVTVPTEKTTIPTEKTTISTEKPMVPTEKTTIPT
EKTTIPTEKVTVPTEKTTIPTEKTTISTEKATVPTEKTTIPTEKTTISTEKATVPTEKTT
IPTEKATVPTKTTTIPTEETTISTEKTTVPTKKTTIPTKKTTIPTEKPTVPTERPTPPMT
PQPSPALVPTQPTVFTKPTTSVTPVTPATTTTPRPTPATCPPNAHYERCACPESCQSPKP
TCGLLCKPGCVCNSGFLFHDSRCINASSCNCFYNENYYKSGTEWFSPNCTERCRCQPGSQ
IECQPYKCGTNTVCQLKHGQYRCHPYGTATCFVYGDPHYFTFDGRYFNFMGKCTYLLAQP
CGNSTGPEPFFRVTVKNEQRGLEGVSCLSKVSVTLSETTITLLKGRHTLVGGQRVTLPAI
PSGGVFLTPSGRFVQLQTAFGLRVRWDGDQQLYVRVPSTYSSKLCGFCGNYDGDSSNDNQ
KPDGRPARDEKELGHSWQISEDEDQACQENQASLPSCDTDLKNTLSSPEHCGRLVVANGA
FQACLPHLKVSSFFHNCKLDMCNFQGLQQILCAHMSALTETCQEAGYAVKPWRGPQFCPL
ACPPNSRYTLCAKLCPDTCHSTFLGMACQNRCVEGCECNQGFVLSGLQCVPRSECGCLDP
TAGYFKIGERWFKPGCRQLCICEGTNRTRCVPWQCQAQEMCGQQDGTYGCHPQGSATCTV
WGDPHYLTFDGALHHFMGTCTYILTRPCLLKSLENYFFVSATNEFRGGNLEASYVKAVQV
QAFGIRVWMLKGRKVMLDGRQVALPLWFAHGRMTVRSSGSFILLYTDFGLQVRYDGYHLV
EVTAPSSYAGRLCGMCGNYNNNSLDDNLQPDKRPAVNSVRLGASWKLNELSESGCFAADA
RPPRCLEKNATDPWSKNCDILVNPQGPFSTCHRVVSPQASFASCVYGQCGTKGDAFTLCR
SLQAYASLCARAGQVLTWRSSTFCPLKCPSGSRYSPCADPCPGTCLSLSTPSYCPSSLPC
AEGCECQRGHILSGTTCVPLSECGCTSPGGAYHPVGERWYTDNTCSRLCTCSIHNNISCL
QTSCKPGQMCWPRDGLMRCRGAGMGVCQIQDRSQYISFDGSYHAVRGACTYVLAKTCHST
MDLPFFKISGKNGKQQDQAHTFYLRKVYVHVFNTLVTLKKDHVLINGTWVPLPATSQIRG
VKVISRDGYMVLTISIGVEVKFDGSGFLEIEIPKAYYGKTCGMCGNFNGEEEDELLMPND
ELAPDDITYVDSWQDKEIDPSCRDDDKAEEESEEPETTCQPADLERAKEQCQAVFQTPGW
ARCASRVILSPFLVRCTDSLCEFGGLSSTLCQSLQAFATACQARGIRPPIWRNSSFCPLD
CPPNYVYTNCFPHCPPTCDNPEGRCKGSSGPSVCQEGCVCEPGYVLKERRCVPRSQCGCR
DARGRFLPEGNAWFSNSCSQRCTCGAGAIQCRPFACPEGSRCEINEDDKEICKPYKSERC
TVYGDPTYRTFDGLGYRFQGRMTYYLVKTVDVLPTGVEPFIVEGRNKMYASHNPVFLHEI
IVMVYGYTVQLQHELELVVNGQKVTAPYEPVDQLRVSLRSDRLFVITDFELVVSFNGKNN
AVISLPLTYRKLVLGLCGNCDQNKRNDFMLPNGAVTQNLLAFGNSWEVKMTEGSLPRVSR
AVQEEEVKEEAALGFLDVSGCHPEELQLINRTQACGVLADPEGPFAVCHQTVAPEPFLEH
CVSDLCGTRDPKEQEGLRCQVLSGYASICQEAGATPASWRDHTHCALSCPANTVYQSCMT
PCPASCATLAAPRGCKGPCVEGCASLPGYVYSGAQSLPLAHCGCTENGIYYQQGDSFVND
DCSQRCTCARTGFLLCEPLGCSPGEVCTLGNLTRGCFRDSPCLQNPCQNDGRCWEQGTHF
TCECEPGYGGDRCMELQDVPPPEKPEASNFASILLPLLVPMVVIVPAAVTRGCISRRKGR
RSSREKMRSQTRGKPPHADFSPEQALRVA
Download sequence
Identical sequences E1BNL3
ENSBTAP00000041534 ENSBTAP00000041534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]