SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041939 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041939
Domain Number 1 Region: 21-345
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.32e-123
Family Transferrin 0.000000000516
Further Details:      
 
Domain Number 2 Region: 357-620
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.12e-109
Family Transferrin 0.0000000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041939   Gene: ENSBTAG00000023411   Transcript: ENSBTAT00000044444
Sequence length 622
Comment pep:known chromosome:UMD3.1:1:136747035:136790649:-1 gene:ENSBTAG00000023411 transcript:ENSBTAT00000044444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLVICSLLCAGALGLCLAVPERTVRWCTVSNLEASKCYSFHDNMKKVLSVESPHVTCVK
RTSYLDCIRAIAAHEADAVMVDGGLVYEAGLKPYNLKPVVAEFYGSKDDPQTHHYVVAVV
KKGSNFQLNQLQGKKSCHTGLGWSAGWNIPMRMLLPSDWSQKAAAKFFAGSCVPCADQSN
FPKLCQLCAGKGMDKCACSHHEPYFGYSGAFKCLQDGVGDVSFVRHLTVFENLANQADRD
QYELLCRENTRRPVHEYKGCHLARIPSHAVVARSVDGKEDLIWELLSQAQEHFGKDKSAE
FQLFYSPHGKDLLFTDAAIGFLRVPPKMDAKLYLGYEYFSVIQHLGRVSQDGKEQLGSKC
VNTPMKGYYVVAVVKKSDANLTWNSLRGKKSCHTAVGTSAGWNIPMGFLYNQTGSCKLDE
FFSQSCAPGSDPESSLCALCRGSFKPAHMCAPNSHEQYYGSSGALRCLVEKGDVAFVKHP
TVLQNTDGKNPEAWAKNLKPEDFQLLCLDGSRKPVTEAQSCHLAIVPSHAVVSRKDKADF
VRRMLFNQQELFGRNGFEYMMFQLFKSPAKDLLFSDDTECLANLQDRTTYQKYLGPEYLQ
AIANVKHCLRSELLDACTFHGN
Download sequence
Identical sequences E1BI82
ENSBTAP00000041939 ENSBTAP00000041939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]