SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042078 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042078
Domain Number 1 Region: 955-1168
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.1e-103
Family Thrombospondin C-terminal domain 0.00000000553
Further Details:      
 
Domain Number 2 Region: 25-226
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.47e-39
Family Laminin G-like module 0.0000114
Further Details:      
 
Domain Number 3 Region: 832-954
Classification Level Classification E-value
Superfamily TSP type-3 repeat 6.28e-36
Family TSP type-3 repeat 0.000000411
Further Details:      
 
Domain Number 4 Region: 763-834
Classification Level Classification E-value
Superfamily TSP type-3 repeat 3.01e-17
Family TSP type-3 repeat 0.00023
Further Details:      
 
Domain Number 5 Region: 491-542
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 7.06e-16
Family TSP-1 type 1 repeat 0.00015
Further Details:      
 
Domain Number 6 Region: 434-489
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000157
Family TSP-1 type 1 repeat 0.0000859
Further Details:      
 
Domain Number 7 Region: 690-775
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000114
Family TSP type-3 repeat 0.00013
Further Details:      
 
Domain Number 8 Region: 318-376
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000711
Family VWC domain 0.0062
Further Details:      
 
Domain Number 9 Region: 381-423
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000575
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 10 Region: 547-600
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000921
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042078   Gene: ENSBTAG00000018810   Transcript: ENSBTAT00000044595
Sequence length 1170
Comment pep:known chromosome:UMD3.1:9:104735657:104760261:-1 gene:ENSBTAG00000018810 transcript:ENSBTAT00000044595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWPLLLLALWAWPSAQAGDQDEDTAFDLFSISNINRKTIGAKQFRGPDPSVPAYRFVRF
DYIPPVSAEHLGRITEAMRRKEGFFLTASMKQDRRSRGTLLALEGPGATHRQFEIVSNGP
ADTLDLTYWVDGTQHVISLEDVGLADSQWKNVTVQVTGETYSLYVGCDLMDSFALDEPFY
EHLQTERSRMYVAKGAARESHFRGLLQNVYLVFENSVEDLLSKKGCQQSQGAETNAISEN
TETLHLSPMVTMEHVGPSAEKSPEVCEHSCEELGSMIRELSGLHVIVNQLHENLRKVSND
NQFLWELIGGPPKTRNVSACWQDGRFFAENETWVVDSCTKCTCKKFKTVCHQISCPPATC
ADPWFVEGECCPSCVHDGEEGWSPWAEWTECSATCGSGTQQRGRSCDVTSNTCLGPSIQT
RACSLGRCDHRIRQDGGWSHWSPWSSCSVTCGVGNVTRIRLCNSPVPQMGGRSCKGSGRE
TKACQGPPCPVDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQHGGKDCVGGAKEQQM
CNRKSCPIDGCLSNPCFPGAECSSFPDGSWSCGSCPGGFLGNGTHCEDLDECAVVTDVCF
ATSKAHRCVNTNPGYHCLPCPPRYKGNQPFGVGLEAARTEKQVCEPENPCKDKTHSCHRH
AECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNKNLVCATNATYHCVKDNCPL
LPNSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQFDYDKDEVGDRCDNCPYV
HNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPLVH
NPDQTDVDNDLVGDQCDNNEDIDEDGHQNNQDNCPYIPNANQADHDRDGQGDACDSDDDN
DGIPDDRDNCRLVANPDQEDSDGDGRGDACKDDFDNDSIPDIDDVCPENNAISETDFRNF
QMVHLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDRDD
DYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRNAL
WHTGNTEGQVRTLWHDPKNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPIYD
QTYAGGRLGLFVFSQEMVYFSDLKYECRGV
Download sequence
Identical sequences F1N1W3
ENSBTAP00000042078 ENSBTAP00000042078 9913.ENSBTAP00000042078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]