SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042093 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042093
Domain Number 1 Region: 392-518
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000361
Family Growth factor receptor domain 0.007
Further Details:      
 
Domain Number 2 Region: 328-366
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000502
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 3 Region: 296-332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000803
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000042093
Domain Number - Region: 261-295
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0449
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042093   Gene: ENSBTAG00000031476   Transcript: ENSBTAT00000044610
Sequence length 722
Comment pep:known_by_projection chromosome:UMD3.1:9:105508313:105516028:-1 gene:ENSBTAG00000031476 transcript:ENSBTAT00000044610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGRCALTLAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFF
RVCLKHYQASVSPEPPCTYGSAVTPVLGTDSFSLPDGAGADPAFSNPIRFPFGFTWPGTF
SLIIEALHTDSPDDLATENPERLISRLATQRHLAVGEEWSQDLHSSGRTDLKYSYRFVCD
EHYFGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGQYCTEPICLPGCDEQHGFCDKP
GECKCRVGWQGRYCDQCIRYPGCLHGTCRQPWQCNCQEGWGGLFCNQDLNYCTHHKPCRN
GATCTNTGQGSYTCSCRPGYTGANCETEVDECSAGPCRNGGSCTDLENSYSCTCPPGFYG
RICELSAMVCADGPCFNGGRCSDNPEGGYTCRCPGGFSGFNCEKKTDSCSSSPCSNGAQC
VDLGDAYACRCQAGFSGRHCDNNVDDCASSPCAHGGTCRDGVNEYSCTCPPGYTGRNCSA
PVSRCEHAPCHNGATCHERAFRYLCECARGYGGPNCQFLLPEPPPGPVVVDLTEKYVEGQ
AGPFPWVAVGAGVLLVLTLLLGCAATVVCVRLRLQKRRPPADPCRGETETMNNLANRQRE
KDISVSVIGATQIKNTNKKADFHVEPGAEKNGLTARDSAVGCNLLQGLKGAAATAGPHSV
RDAKGQPQGSAGEEKGTPTLRGGEASERKRPDSVYSASKDTKYQSVYVISEEQDECVIAT
EV
Download sequence
Identical sequences E1BN18
XP_010807105.1.76553 XP_015320421.1.59421 ENSBTAP00000042093 ENSBTAP00000042093 9913.ENSBTAP00000042093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]