SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042391 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042391
Domain Number 1 Region: 116-237
Classification Level Classification E-value
Superfamily L domain-like 5.1e-16
Family Internalin LRR domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042391   Gene: ENSBTAG00000031704   Transcript: ENSBTAT00000044952
Sequence length 251
Comment pep:known chromosome:UMD3.1:1:100345023:100375298:-1 gene:ENSBTAG00000031704 transcript:ENSBTAT00000044952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESSSGQNTSDQKTCPSNSSYSSYLSEIHTLWALSRNRTLYSRSDSGISSLLPSDSFKY
LTWHKGEQNDIQGSQLRCPRVREGPSAEELLFREEECTLPSQKRVLEKNKWETWLQENWE
DCTNLNLSFQDLGDPYQVENFNRILRRLIRVETLWLVDNSLVDLSALRLPSCRVLNMNKN
HLTSFKQLPKIPQIQHLSLADNHIETLTGLSSLRCTPLESLILKRNPCEFHQNYRKRSSN
KKTAQFKRERT
Download sequence
Identical sequences Q32KQ4
NP_001070590.1.59421 NP_001070590.1.76553 ENSBTAP00000042391 ENSBTAP00000042391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]