SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042458 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042458
Domain Number 1 Region: 266-446
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.66e-62
Family SPRY domain 0.0000118
Further Details:      
 
Domain Number 2 Region: 2-113
Classification Level Classification E-value
Superfamily Immunoglobulin 7.02e-21
Family V set domains (antibody variable domain-like) 0.00024
Further Details:      
 
Domain Number 3 Region: 125-205
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000276
Family C1 set domains (antibody constant domain-like) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042458   Gene: ENSBTAG00000010852   Transcript: ENSBTAT00000045031
Sequence length 497
Comment pep:novel chromosome:UMD3.1:23:31343551:31373121:-1 gene:ENSBTAG00000010852 transcript:ENSBTAT00000045031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTVLGPAYPILAVVGEDATLRCHLSPEKNAEDMEVRWFRTQFSPAVFVYKGRRERTDEQM
EQYRGRTTFVSEAISEGSVGLIIHNVTAHENGIYCCYFQEGRSYDEAIMHLTVTGLGSKP
VIEMKSPEDGGIRLECTSAGWYPKPHAVWRGPHGETMPPLEEAYTVSADGLFLVTMAVII
RDHSVRNMSCSVINTLLDQEKETVIFIPESFIPRTSPWMVALVVILPSLLLLIAGSIYLI
KELGKERVEKEKECQTKEQLQEELRWRRNLLHAADLLRDPHFTHPSLYLYEENYPLRFED
RRQKSPDKLQRYXSWPCVMGREAFTSGRHYWEVEVGDRTDWAIGVCRENVMKKGFDPMTP
ENGFWAVELYGNGYWALTPLRTPLPLAGPPRRVGVFLDYESGDIFFYNMTDGSHIYTFSK
ASFSGPLRPFFCLWSCGKKPLTICPVTDGLEGVMVVADAKDISKEIPLSPMGEDSASGDI
ETLHSKLIPLQPSQGVP
Download sequence
Identical sequences F1MZI6
ENSBTAP00000042458 ENSBTAP00000042458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]