SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042505 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042505
Domain Number 1 Region: 521-683
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000111
Family SPRY domain 0.029
Further Details:      
 
Domain Number 2 Region: 50-211
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000791
Family SPRY domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042505   Gene: ENSBTAG00000010519   Transcript: ENSBTAT00000045089
Sequence length 1559
Comment pep:known chromosome:UMD3.1:19:27656328:27668154:-1 gene:ENSBTAG00000010519 transcript:ENSBTAT00000045089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSGGNGGSGGGPGPGPGGGGGPGGSGPGPGSGGSLGSSGELHPRTGRLVSLSACGRT
ARRQQPGQEFNHGLVLSREPLRDGRVFTVRIDRKVNSWSGSIEIGVTALDPNVLDFPSSA
TGLKGGSWVVSGCSVLRDGRSVLEEYGQDLDQLGEGDRVGVERTAAGELRLWVNGRDCGV
AATGLPARVWAVVDLYGKCTQITVLPPEPGFSPPTPSPTPPLEPSAPAEDSALAEQGTSG
DEAFMVSPAQARPETFPNSLESHNDFAGMELSEVVSNAILSAYNGGLLNVNLSSPPAGEA
PGSSGAATSPIVTSNDALLFHEKCGTLIKLSNNNKTAERRRPLDEFNNGVVMTNRPLRDN
EMFEIRIDKLVDKWSGSIEIGVTTHNPNNLEYPATMTNLQSGTIMMSGCGILTNGKGTRR
EYCEFSLDELQEGDHIGLTRKSNSALHFFINGIDQGVATPLTPPVVYGVVDLYGMAVKVT
IVHNNNHSDRLRRNNAILRALSPEGALRRAAPTTQAEPERLLFHPNCGQKAAITHEGRTA
LRPHATDDFNHGVVLSSRALRDGEVFQVRIDKMVDKWAGSIEIGVTTHNPAYLQLPSTMT
NLRSGTWMMTGNGVMHNGTTILDEYGHNLDRLKAGDTVGVVRREDGTLHFFVNGMTQGPA
AWNVPPGVYAVVDLYGQAAQATIVDDVEVPQVPEPLPEGNNQVSPSSPSSGAGGSDLRFH
QLHGSNAVITNGGRTALRHNCRSEFNDAIVISNRALRDGELFEIVIQKMVDRWSGSIEAG
VTAIRPEDLEFPNTMTDIDYDTWMLSGTAIMQDGNTMRNNYGCDLDALGTGARIGMMRTA
KGDLHYFINGQDQGAACSGLPPEVYAVVDLYGQCVQVSITNATGPMDNSLATSNSATEKS
FPLHSPVAGVAHRFHSICGKNIALEEDGTRAVRAAGYAHGLVFSTKELKSEEIFEVKVEE
LDEKWAGSLRLGLTTLAPGDMGPGAGGGPGLPPSLPELRTKTTWMVSSCEVRRDGQLQRM
NYGRNLERLGVGSRVGIRRGADDTMHILVDGEDMGPAATGIAKSVWAVLDLYGPVRSVSI
VSSTRLDEPEGTQPPSPSSDTGSEGEEDDEGEEHGLEGQNQVAIMPTALEFLENHGKNIL
LSNGNRTATRVASYNQGIVVINQPLVPQLLVQVRIDFLNRQWTSSLVLGVITCPPERLNF
PASACALKRAAWLLRGRGVFHNGLKICEKFGPNLDTCPEGTILGLRLDSSGGLHLHINGM
DQGVAVPDVPQPCHALVDLYGQCEQVTIVSPEPGAASGKSAGTQGDMEKADMVDGIKESV
CWGPPPTTSPLKSCEYHALCSRFQELLLLPEDYFMPPPKRSLCYCESCRKLRGDEAHRRR
GEPPREYALPFGWCRFNLRVNPRLEAGTLTKKWHMAYHGSNVAAVRRVLDRGELGAGTAS
ILSCRPLKGEPGTGFEEPGENCAPPREEQPPPVLLSPSLQYAGAETLASKVQFRDPKSQR
THQAQVAFQVCVRPGSYTPGPPSAALREPPDPHFSPAELEWVTKEKGATLLYALLVRVE
Download sequence
Identical sequences F1MXX8
NP_001179590.1.59421 NP_001179590.1.76553 ENSBTAP00000042505 ENSBTAP00000042505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]