SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042513 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042513
Domain Number 1 Region: 111-412
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.69e-69
Family Quinoprotein alcohol dehydrogenase-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042513   Gene: ENSBTAG00000031810   Transcript: ENSBTAT00000045099
Sequence length 485
Comment pep:known_by_projection chromosome:UMD3.1:18:43716018:43763140:1 gene:ENSBTAG00000031810 transcript:ENSBTAT00000045099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASQSSGTPSSSKKSSEDGKETPQKSNLPLSLLHIRDVTHRRPSNLPWVDVVRACGRFRL
SLLQARRSRLLPSLNPLAVGDESPPPDTLWMPWMTQKALWGDQEPLSKIPFKIMRGHEHI
VSSCNFCVDDTKVLSGSYDCTVKLWDAMDGSIVRDFEPVPEGPVLECSITADSRRIVAAS
YDKTVRAWDVETGKLLWKLSHETFIVSAKCSPDGKYVVLGLDVDHGIFIIDAKDSTTVSR
IKDHHMMSLTACCFDPDSQRVASVSFDRSIKIWDVTSQTTLLTITKAHNNAISNCCFTFS
GHFLCTSSWDKTLKIWNVHTGEFRNRGACVTLMQGHEGCVSSCRFARDTSFLVSGGFDKT
VAIWDVEEGYRKLSLKGHNDWVMDVSISNNKKWILSASKDRTVRLWNIEEIDQIPLVIEH
KKTRGLKVKQCEECDSPFSIYESDIFSETVTKCVLCRMNETDLSTEASHSSEGEASLSRE
SSPDE
Download sequence
Identical sequences E1BFT8
9913.ENSBTAP00000042513 ENSBTAP00000042513 ENSBTAP00000042513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]