SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042532 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000042532
Domain Number - Region: 135-165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000177
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 198-230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000698
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 167-197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000957
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 231-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00509
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042532   Gene: ENSBTAG00000014758   Transcript: ENSBTAT00000045118
Sequence length 300
Comment pep:known chromosome:UMD3.1:5:48917722:49009466:1 gene:ENSBTAG00000014758 transcript:ENSBTAT00000045118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKSAFPAGALWLWSILPCLLVLRAEVGQQPEESLYLWIDAHQARVLIGLEEDILIVSE
GKMAPFTHDFRRAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVN
VPLLGTVPHKASVLCSPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSATCFNGGTCFYP
GKCICPPGLEGEQCETSKCPQPCRNGGKCIGKNKCKCSKGYQGDLCSKPVCKPGCGTHGT
CHEPNKCQCREGWHGRHCNKRYGASLLHTLRPAGAQLRQHTPSVKKAEERQDPPESNYIW
Download sequence
Identical sequences Q17QW8
NP_001069464.1.59421 NP_001069464.1.76553 ENSBTAP00000042532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]