SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042592 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042592
Domain Number 1 Region: 627-778
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-38
Family SPRY domain 0.006
Further Details:      
 
Domain Number 2 Region: 439-535
Classification Level Classification E-value
Superfamily Fibronectin type III 5.59e-17
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 3 Region: 221-284
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000229
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Domain Number 4 Region: 2-51
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000053
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042592   Gene: ENSBTAG00000010103   Transcript: ENSBTAT00000045179
Sequence length 788
Comment pep:known chromosome:UMD3.1:10:43871178:43988950:-1 gene:ENSBTAG00000010103 transcript:ENSBTAT00000045179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEMEEELKCPVCGSFYREPIILPCSHNICQACARNILVQTPESESPQSRRASGSGVSDY
DYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALASV
PRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATV
MCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMY
CVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRN
MVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKL
RQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLSLDNS
PLLQSIHQLDFVQMKASSPVPATPILQLEDCCTHNNSATLSWKQPPLSTVPAEGYILELD
DGNGGQFREVYVGKETMCTVDGLHFNSTYNARIKAFNKTGVSQYSKTLVLQTSEAIVTHE
IKPMKYTDSEEQTVPFPVPSERLPLRRMSPFSSTLNLQPSFPGRAYFDFRSSPHQLSLHS
SLQSLNAPGCNFETQSASYSQLVDIKKLLAVAWFAFDPGSAHSDIIFSNDNLTVTCSSYD
DRVVLGKTGFSKGVHYWELTVDRYDNHPDPAFGVARIDVMKDVMLGKDDKAWAITEGGIT
KGATIGVLLDFNRKTLTFFINDEQQGPIAFENVEGLFFPAVSLNRNVQVTLHTGLQVPDF
YSSRASIA
Download sequence
Identical sequences F1N068
ENSBTAP00000042592 ENSBTAP00000042592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]