SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042771 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042771
Domain Number 1 Region: 86-267
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-35
Family SPRY domain 0.004
Further Details:      
 
Domain Number 2 Region: 1245-1297
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000151
Family RING finger domain, C3HC4 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042771   Gene: ENSBTAG00000011588   Transcript: ENSBTAT00000045376
Sequence length 1313
Comment pep:known_by_projection chromosome:UMD3.1:22:51054914:51078183:-1 gene:ENSBTAG00000011588 transcript:ENSBTAT00000045376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKEGGMAFSRKSYKLTSDAERSRVTGIVHEKLLSDYLHRVFASPDHRPAAATSRKPLN
FQNLPEHLDQLLHVDDKEDEESQEQVEGRLGPSTVVLDHTGGFEGLLLVDDDLLGVIGHS
NFGTIRSTTCVYKGKWIYEVLISSQGLMQIGWCTINCRFNQEEGVGDTHNSYAYDGNRVR
KWNVTTTNYGKAWAAGDIVSCLIDLDEGTLSFSLNGVSLGTAFENLSRGLGMAYFPAISL
SFKESVAFNFGSRPLRYPVAGYRPLQDPPSTSLVRAQRLLGCFRAVLSMELDPVEGRLVE
KESSEWQLQGQPTVLLTLAHIFHHFAPLLCEVYVVEAVLMSFLLGVVEAGPPEQAQTVVH
HVLDLLWLFMEDYEVQDCLKQLMMSLLRLYRFSPIVPDLSLQIHYLRLTIAILSHEKSRK
FLLSNVLFDVLRSVVFFYIKSPLRVEEAGLQELIPTTWWPHRSPREGKEEVREETSEERL
RRRAYERGCQRLKKRIEVVEELQVQILKLLLNNKDNNGGEASRYIFLTKFRKFLQENASG
RGNTPMLCPPEYMVCFLHRLISALRFYWDEYKASKPRTSFSEEAYVPPQIFYNGKVDYFD
LQRLGGLLSHLRKTLKDDLASKANILIDPMELQATTMDDLDEDEEPAPAAAQRPMQALAV
GGALPLPRPGWLSSPTLGRANRFLSTAAVSLMTPRRPLSASEKVKVRTLSAEQRTREDIE
GSQWNEGLLVGRPPEEPEHPLTENSLLEVLDGVVMMYNLSVHQQLGKMVGVSDDVNEYAM
ALRDTEDKLRRCPKRRKDILAELSKSQKVFSEKLDHLSRRLAWVHAAVYSQEKMQDIYWL
LRVCLRTIEHGDRTGSLFAFMPEFYLSVAINSYSALKNYFGPVHSMEELPGYEETLTRLA
AILAKHFADTRIVGTDIRDSLMQALASYVCYPNSLRAVERIPEEQRIAMVRNLLAPYEQR
PWAQTNWILVRLWRGCGFGYRYTRLPHLLKTKPEDASLPSLQKPCPSTLLQQHMADLLRE
GPDVAPSFLNSVLNQLNWAFSEFIGMIQEIQQAAERLERNFVDSRQLKVCATCFDLSVSL
LRVLEMTITLVPEIFLDWARPTSEMLLRRLAQLLNQVLNRVTAERNLFDRVVTLRLPGLE
SVDHYPILVAVTGILVRLLVHGPASGTERATSVLLADPCFQLRSISYLLGQPEPPAPGTA
LPAPDRKHFSLQSYTDYINVEELAQVEQMLAHLTSASAQAAAASLPTSEEDLCPICYAHP
ISAVFQPCGHKSCKACIDQHLMNNKDCFFCKATIVSVEDWDKAAHASATSSAA
Download sequence
Identical sequences E1BL26
ENSBTAP00000042771 ENSBTAP00000042771 NP_001179993.1.59421 NP_001179993.1.76553 XP_005222848.1.76553 XP_005222849.1.76553 XP_015315048.1.76553 XP_015315049.1.76553 XP_019839825.1.53367 XP_019839826.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]