SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042983 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042983
Domain Number 1 Region: 559-812
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.14e-89
Family Eukaryotic proteases 0.000094
Further Details:      
 
Domain Number 2 Region: 347-453
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000366
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 
Domain Number 3 Region: 85-165
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000327
Family SEA domain 0.0058
Further Details:      
 
Domain Number 4 Region: 496-527
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 5 Region: 532-571
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 245-329
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000085
Family Spermadhesin, CUB domain 0.0068
Further Details:      
 
Domain Number 7 Region: 461-493
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042983   Gene: ENSBTAG00000032152   Transcript: ENSBTAT00000045605
Sequence length 813
Comment pep:known_by_projection chromosome:UMD3.1:5:75870208:75903553:-1 gene:ENSBTAG00000032152 transcript:ENSBTAT00000045605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARLCPTLVCFLARMPMAKAPQAAGGQGDGGDGEEAEPEGMFKAPKDAKRKVRDYLRLAPL
WLALVMLASVGVLLWYFLGYKAEVTVSQVYSGSLRVLNRHFSQDLARRESSAFRSETAKA
QKMLKELIASTPLGTYYNSSAVYSFGEGPFTCFFWFILQIPEHRRPMLSPDVVRALLAEE
LLSAVNSSAPAPYRTEYEVDPEGLVILEASVKDIVALNSTLGCYRYSYVGQGQALRLKGP
DTLASSCLWHLQGPQDLMLKLRLEWKLADCRDRLAMYDVAGPLERRLITSVYGCSRQEPV
VEVLASGAIMAVVWKKGLHSYYDPFVLSVQPVTIQACEVNLTLEGRLEPQGVLSTPYFPS
YYSPSTHCSWHLTVPSLDYGLALWFDAYALRRQKYNMPCTQGQWTIQNRRLCGLRTLQPY
AERIPVVASAGITINFTSQISLTGPGVQVHYSLYNQSDPCPGEFLCSVNGLCVPTCDGVK
DCPNGLDERNCVCRATFQCQEDSTCIPLSRVCDRQPDCLNGSDEEQCQEGVPCGTFTFRC
EDHSCVKKPNPQCDGHPDCRDGSDEQHCDCGLQGPLGRIVGGAVSSEGEWPWQASLQVRG
RHICGGALIADRWVITAAHCFQEESMASPALWTVFLGKVWQSSRWPGEVSFKVSRLLLHP
YHEEDSHDYDVALLQLDHPVVRSATVQPICLPARSHFFEAGLHCWITGWGALREGGPTSN
GLQKVDVQLIPQDLCSEAYRYQVTPRMLCAGYRNGKKDACQGDSGGPLVCKEPSGRWFLA
GLVSWGLGCGRPNYFGVYTRITGVIGWIQQVLT
Download sequence
Identical sequences F1MWW8
9913.ENSBTAP00000040885 9913.ENSBTAP00000042983 ENSBTAP00000042983 ENSBTAP00000042983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]