SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000043064 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000043064
Domain Number 1 Region: 307-532
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.2e-24
Family Clostridium neurotoxins, the second last domain 0.064
Further Details:      
 
Domain Number 2 Region: 122-229
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000243
Family Cadherin 0.0042
Further Details:      
 
Domain Number 3 Region: 57-134
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000914
Family Cadherin 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000043064   Gene: ENSBTAG00000011823   Transcript: ENSBTAT00000045695
Sequence length 951
Comment pep:known_by_projection chromosome:UMD3.1:16:44633323:44671659:1 gene:ENSBTAG00000011823 transcript:ENSBTAT00000045695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNKHKPWLEPTYHGLVTESDSTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEICGFKIH
GQNVPFDAVVVDKSTGEGVIRSTEKLDCELQKDYTFTIQAYDCGKGPDGANVKKSHKATV
HIQVNDVNEYAPVFKEKSYKATVVEGKQYDSILRVEAVDADCSPQFSQICSYEIVTPDVP
FTVDKDEGYIKNTEKLNYGKEHQYKLTVTAYDCGKKRAAEDVLVKISIKPTCTPGWQGWN
NRVEYEPGTGALTLFPNVHLETCDESVASAQVVVELETSHIGKGCDRDTYSEKSLHRLCG
AASGTAELLPSPGGSWNWTIGLPTDNGHDSDQVFEFNGTQAVRVPDGIVSVNPKEPFTIS
VWMRHGPFGKKKETILCSSDKTEMNRHHYSLYVHGCRLVFLLRQDPSEEKKYKPAEFHWK
LSQVCDEEWHHYVLNVEIPSVTLYVDGVPHEPFSVTEDYPLHPSKIETQLVVGACWQEYS
GVESDNETEPVPLASAGGDLRMTQFFRGNLAGLTIRSGKLTDKKVIDCLYTCKEGLDLHT
PEDNGRGVKIQANPSQSTLTLEGEDVGELDKAMQHVSYLNSRQFPTPGIRRLKITSTVKC
FNEATCISIPPVDGYIMVLQPEEPKISLSGIHHFARAASEFESSEGVFLFPELRIISTIT
REVEPEGEGDEDPTVQESLVSEEIVHDLDTCEVTVEGEELNGEQESLEVDAARLQQKGIE
MSSSDMGVVFTGVDTMASYEEILHLLRYRNWHTRSLLDRKFKLVCSELNGRYVSKEFQVE
VNVIHTANPMEHASHIAAQPQFVHPEHRSFIDLSGHNLANPHPFAVVPSTATVVIVVCVS
FLVFMIILGVFRIRAAHQRTMRDQDTGKENEMDWDDSALTITVNPMETYEDQHSSEEEEE
EEEEESEDGDEEDDITSAESESSEEDEGEHGDPQTSNRQQQLEWDDSTLSY
Download sequence
Identical sequences F1MD95
9913.ENSBTAP00000043064 ENSBTAP00000043064 ENSBTAP00000043064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]