SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000043090 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000043090
Domain Number 1 Region: 5-261
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.66e-99
Family Carbonic anhydrase 0.00000000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000043090   Gene: ENSBTAG00000032236   Transcript: ENSBTAT00000045723
Sequence length 261
Comment pep:known chromosome:UMD3.1:14:79520633:79530892:1 gene:ENSBTAG00000032236 transcript:ENSBTAT00000045723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPDWGYDGENGPEHWGKLYPIANGNNQSPIDIKTSETKRDPSLKPLSVSYNPATAKEI
VNVGHSFHVNFEDSDNRSVLKGGPLSESYRLRQFHFHWGITDDCGSEHLVDGAKFSAELH
LVHWNSAKYPSFADAASQADGLALIGVLVKVGQANPNLQKVLDALKAVKNKNKKAPFTNF
DPSVLLPPSLDYWAYSGSLTHPPLHESVTWIIFKETISVSSEQLAQFRSLLANAEGDREV
HIKQNNRPPQPLNGRTVKASF
Download sequence
Identical sequences Q1LZA1
ENSBTAP00000043090 9913.ENSBTAP00000043090 NP_001068934.1.59421 NP_001068934.1.76553 ENSBTAP00000043090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]