SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000043206 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000043206
Domain Number 1 Region: 361-421
Classification Level Classification E-value
Superfamily BPTI-like 1.08e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0052
Further Details:      
 
Domain Number 2 Region: 235-297
Classification Level Classification E-value
Superfamily BPTI-like 2.55e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0041
Further Details:      
 
Domain Number 3 Region: 312-351
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000615
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000043206   Gene: ENSBTAG00000004086   Transcript: ENSBTAT00000045851
Sequence length 513
Comment pep:known chromosome:UMD3.1:10:36490427:36504314:1 gene:ENSBTAG00000004086 transcript:ENSBTAT00000045851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGRLSRARIPAVAVWLLCALVLQGAEAGPPPVTPGLLTADGCLNRFTPGVPDFVLDTD
ASVRNGATFLRSLTARRGRDCVHACCSSNDCNLALVELQPDGGEDAIVSCFLINCLYEQN
FVCKFAPREGFINYLTREVYRSYRELRTQGFRGSRIPMAWDGIDLKVQPQEPLVLKGVEN
TDWRLLRGDTDIRVERNDPDQVELWGLKEGSYLFQLTATGSDQPERTSNVTVTVLSPEQT
EEYCLASRKVGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEECKLACRNVQGP
SAERHHPVCSGSCHSSKFRCGDGCCIDSFLECDDTPDCPDASDEATCEKYTRDFDKLQRI
HFPGDKGHCVDMPDTGLCSESIPRWYYNPFTEHCARFTYGGCYGNKNNFEEEEQCLESCR
GISKKDVFGLRRESPVPNTGSLPPPGPVEVAIAVLLGTCIVVVVAILGYCFFKNQRKDFH
RHRHPPPSTPTSSKVSTTDDMEHLVYYQTTRPL
Download sequence
Identical sequences Q2KJJ7
ENSBTAP00000043206 9913.ENSBTAP00000043206 NP_001039832.1.59421 NP_001039832.1.76553 XP_010846271.1.44457 XP_019824096.1.53367 ENSBTAP00000043206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]