SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000043209 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000043209
Domain Number 1 Region: 683-744
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000774
Family VWC domain 0.0029
Further Details:      
 
Domain Number 2 Region: 23-104
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000209
Family VWC domain 0.018
Further Details:      
 
Domain Number 3 Region: 765-834
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000732
Family VWC domain 0.077
Further Details:      
 
Domain Number 4 Region: 853-917
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000115
Family VWC domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000043209   Gene: ENSBTAG00000002878   Transcript: ENSBTAT00000045854
Sequence length 938
Comment pep:known_by_projection chromosome:UMD3.1:1:83416532:83425904:-1 gene:ENSBTAG00000002878 transcript:ENSBTAT00000045854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGPARSARGGHTAGAGQRPPAKPVPAGCSFGGKVYALDETWHPDLGEPFGVMRCVLCACE
APQWGRRARGAGRVSCKNIKPECPTLACGQPRQLPGHCCQTCPQEHSSPEKQPTGLAFEY
PRDPEHRSYSDRGEPGAEDRGRGDGHTDFVALLTGPRSQAVARARVSLQRSSLRFSISYR
RLDRPTRIRFSDSTGSILFEHPAAPTQDGLVCGVWRAVPRLSLRLLRAEQLYVALVTPTQ
PSGEVWGPLIRHRALAAETFSAILTLEGPPQPGIGGIALLTLSDTEDSLHFLLLFRGLLE
SRSGGPAQVPLRLQILHQGKLLRELQANASAQEPGFAEVLPNLTAQEMDWLVLGELQMAL
ERASGPGLRISGHIAARQSCDVLQSVLCGADALIPVQTGAAGSASLTLLGNGSLIYQVQV
VGTGSEVVAMTLETKPQRRNQHTVLCHMVGLQPGGHRAVGICPGLGARGAHMLLQNELFL
NVGTKDFPDGELRGHVAALPYSGHSARHDTLPVPLAGALVLPPVQSQAAGHAWLSLDTHC
HLHYEVLLAGLGGSEQGTITAHLLGPPGMPGPRRLLKGFYGPEAQGVVKDLEPELLRHLA
QGSASLLITTKGSPQGELRGQVHIANQCEVGGLRLAAAGDQEVQAPGALEAVAAMVAPLP
AVPGPDTPVPARPGGPSRLRDPNTCFFEGQQRPHGARWAPNYDPLCSLCICQRRTVICDP
VVCPPPSCPSPVQAPDQCCPVCPGSTEKQDVKDLPGLPRNRDPGEGCYFDGDRSWRAAGT
RWHPVVPPFGLIKCAVCTCKGGTGEVHCEKVQCPRLACAQPVRANPTDCCKQCPVGSGGH
PQLGDPMQADGPRGCRFAGQWFPESQSWHPSVPPFGEMSCITCRCGAGVPHCERDDCSPP
LSCGPGKESRCCSHCTPRRRPAPETRTVPELGKEDEGS
Download sequence
Identical sequences F1MG93
ENSBTAP00000043209 ENSBTAP00000043209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]