SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000043345 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000043345
Domain Number 1 Region: 33-157
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000612
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000043345   Gene: ENSBTAG00000006264   Transcript: ENSBTAT00000046009
Sequence length 643
Comment pep:known chromosome:UMD3.1:25:18124563:18143260:-1 gene:ENSBTAG00000006264 transcript:ENSBTAT00000046009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCLFSPNFMWMAAVVTSWVIIPAATDTSLAKSCSECHSNATCTVDGAATTCACQEGFTG
DGLECVDLDECAVLGAHNCSATKSCVNTLGSYTCVCPEGFLLSSELGCEDVDECAEPGLS
RCHALATCINGEGNYSCVCPAGYLGDGRHCECSPGSCGPGLDCVREGDALVCVDPCQVHR
ILDEYWRSTEYGSGYICDVSLGGWYRFVGQAGVRLPETCVPVLHCNTAAPMWLNGTHPSS
DEGIVNRVACAHWSGDCCLWDAPIQVKACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCE
ECRVDEDCKSDNGEWHCQCKQDFNVTDLSLLERRLECGVDDIKLSLSKCQLKSLGFEKVF
MYLHDSQCSGFTERGDRDWMSVVTPARDGPCGTVMTRNETHATYSNTLYLADEIIISDLN
IRINFACSYPLDMKVSLKTSLQPMVSALNISMGGTGTFTVRMALFQSPAYTQPYQGSSVT
LSTEAFLYVGTMLDGGDLSRFVLLMTNCYATPSSNATDPLKYFIIQDRCPRAADSTIQVE
ENGESPQGRFSVQMFRFAGNYDLVYLHCEVYLCDTVNEKCRPTCPETRFRSGSIIDQTRV
LNLGPITRKGGQAAMSRAAPSSLGLLQVWLPLLLSATLTLMSP
Download sequence
Identical sequences F1MCQ0
9913.ENSBTAP00000043345 ENSBTAP00000043345 ENSBTAP00000043345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]