SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000043390 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000043390
Domain Number 1 Region: 164-457
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-73
Family Protein kinases, catalytic subunit 0.00000128
Further Details:      
 
Domain Number 2 Region: 29-167
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.56e-34
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000043390   Gene: ENSBTAG00000010682   Transcript: ENSBTAT00000046062
Sequence length 466
Comment pep:known chromosome:UMD3.1:23:27975619:27989666:-1 gene:ENSBTAG00000010682 transcript:ENSBTAT00000046062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGALSFLLLLLLVATGDADMKGHFDPAKCRYALGMQDRTIPDGDISASSSWSDSTAAR
HSRLESSDGDGAWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSPSYRL
RYSRDGHRWMDWRDRWGQEVILGNEDPGGVVLKDLGPPMVARLLRFKEKLGEGQFGEVHL
CEVESPQDLVSLDFPLSVRKGHPLLVAVKILRSDATKNARNDFLKEVKIMSRLKDPNIIR
LLGVCVQDDPLCMITDYMENGDLNQFLSAHQLEDKATEGPGDGEAAQGPTISYPMLLHVA
AQIASGMRYLATLNFVHRDLATRNCLVGENFTIKIADFGMSRNLYAGDYYRVQGRAVLPI
RWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRAQPFGQLTDEQVIENAGEFFRDQGRQ
VYLSRPPACPLSLYELMLRCWSREPEQRPPFSQLHRFLAEDAVNTV
Download sequence
Identical sequences F1MCM5
ENSBTAP00000043390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]