SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000043683 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000043683
Domain Number 1 Region: 40-373
Classification Level Classification E-value
Superfamily L domain-like 2.61e-60
Family Ngr ectodomain-like 0.0039
Further Details:      
 
Domain Number 2 Region: 426-516
Classification Level Classification E-value
Superfamily Immunoglobulin 2.73e-18
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000043683   Gene: ENSBTAG00000023147   Transcript: ENSBTAT00000031490
Sequence length 614
Comment pep:known_by_projection chromosome:UMD3.1:21:33292504:33294348:-1 gene:ENSBTAG00000023147 transcript:ENSBTAT00000031490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAGGARSMPSPLLACWQPILLLVLGSVLSGSATGCPPRCECSAQDRAVLCHRKRFVAVP
EGIPTETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNLFNLRTLGL
RSNRLKLIPLGVFTGLSNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRA
FSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLNINAIRDYSFKRLYRLKVLEI
SHWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPISTIEGSM
LHELLRLQEIQLVGGQLAVVEPYAFRGLNYLRVLNVSGNQLTTLEESAFHSVGNLETLIL
DSNPLACDCRLLWVFRRRWRLNFNRQQPTCATPEFVQGKEFKDFPDVLLPNYFTCRRARI
RDRKAQQVFVDEGHTVQFVCRADGDPPPAILWLSPRKHLVSAKSNGRLTVFPDGTLEVRY
AQVQDNGTYLCIAANAGGNDSMPAHLHVRSYSPDWPHQPNKTFAFISNQPGEGEANSTRA
TVPFPFDIKTLIIATTMGFISFLGVVLFCLVLLFLWSRGKGNTKHNIEIEYVPRKSDAGI
SSADAPRKFNMKMI
Download sequence
Identical sequences F1MBT2
XP_006080755.1.26621 XP_006080756.1.26621 XP_006080757.1.26621 XP_006080758.1.26621 XP_006208827.1.17985 XP_010953523.1.22495 XP_010953524.1.22495 XP_014408933.1.101512 XP_014408934.1.101512 XP_014413896.1.101512 XP_015314749.1.76553 XP_015314750.1.76553 XP_015314751.1.76553 XP_015324007.1.59421 XP_015324008.1.59421 XP_015324009.1.59421 XP_017922009.1.57651 XP_017922011.1.57651 XP_017922012.1.57651 XP_017922013.1.57651 XP_019839162.1.53367 XP_020756732.1.74333 ENSBTAP00000043683 ENSBTAP00000043683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]