SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000043820 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000043820
Domain Number 1 Region: 49-235
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-45
Family SPRY domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000043820   Gene: ENSBTAG00000032763   Transcript: ENSBTAT00000046528
Sequence length 620
Comment pep:known chromosome:UMD3.1:18:35386426:35452124:-1 gene:ENSBTAG00000032763 transcript:ENSBTAT00000046528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAATADPGAGSPQVGDSSGGATGCGLPSPGEQELSRRLQRLYPAVNQHETPLPRSWSPK
DKYNYIGLSQGNLRVHYKGHGKNHKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGI
GLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINGTC
FYTKNGHSLGIAFTDLPANLYPTVGLQTPGEIVDANFGQQPFLFDIEDYMREWRAKVQGT
VHCFPISARLGEWQAVLQNMVSSYLVHHGYCATATAFARMTETPIQEEQASIKNRQKIQN
LVLEGRVGEAIETTQRFYPGLLEHNPNLLFMLKCRQFVEMVNGTDSEVRSLSSRSPKSQD
SYPGSPSLSPRHGPTSSHTHNTGADSPSCSNGVASTKSKQNHSKYPAPSSSSSSSSSSSS
SSPSSVNYSESNSTDSTKSQPHSSTSNQETSDSEMEMEAEHYPNGVLESMSTRIVNGAYK
HEDLQTDESSMDDGHPRRQLCGGNQAATERIILFGRELQALSEQLGREYGKNLAHTEMLQ
DAFSLLAYSDPWSCPVGQQLDPIQREPVCAALNSAILESQNLPKQPPLMLALGQASECLR
LMARAGLGSCSFARVDDYLH
Download sequence
Identical sequences F1MSI0
ENSBTAP00000043820 ENSBTAP00000043820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]