SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000043824 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000043824
Domain Number 1 Region: 365-704
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.18e-116
Family Transferrin 0.000000338
Further Details:      
 
Domain Number 2 Region: 22-355
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.55e-113
Family Transferrin 0.000000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000043824   Gene: ENSBTAG00000002998   Transcript: ENSBTAT00000046533
Sequence length 739
Comment pep:known_by_projection chromosome:UMD3.1:1:72086119:72109936:-1 gene:ENSBTAG00000002998 transcript:ENSBTAT00000046533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSSVALWLFVTLRTVLGGMEVRWCTISDPEQQKCSDMSKAFQQAGIQPSVLCVQGTSA
DHCVQLITAQEADAITLDGGAIYQAGKEHGLKPVVGEVYDQEIGTSYYAVAVVKRGSQVT
INTLKGMKSCHTGINRTVGWNVPVGYLVESGRLSVMGCDVLRAVSDYFGGSCVPGAGETS
YSESLCRLCRGDSTGEGVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGKT
LPSWGQALLSQDFELLCQDGTRADVTEWRQCHLARVPAHAVVVRADTDGGLIFRLLNEGQ
RLFSHEGSSFHMFSSEAYGQKNLLFKDATSELVPIATQTYEAWLGREYLHAMKGLLCDPN
RLPHYLRWCVLSTPEIQKCGDMAVAFSRQRLKPEIQCVSAESPQQCMERIQAGQIDAVTL
KGEDIYTAGKTYGLVPAAGEHYTPEDRSNSYFVVAVVKRNSSYAFTLDELRGKRSCHPGF
GSPAGWDIPVGTLVQRGFIRPRDCDVLTAVSEFFSASCVPVNNPQNYPSSLCALCVGDEQ
GRNKCVGNSQERYYGYSGAFRCLVENAGDVAFVKHTTVFDNTNGHSSEPWAAELMSEDYE
LLCPNGARAEVTQFAACNLAQIPSHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFKM
FDSSSYHGQDLLFKDATIRVVPVGEKTTYRSWLGPDYVVALEGMLSQQCSGTVTSASRVS
LLLLLLPLALTASLLQPCL
Download sequence
Identical sequences E1BG25
9913.ENSBTAP00000043824 ENSBTAP00000043824 ENSBTAP00000043824 NP_001179241.1.59421 NP_001179241.1.76553 XP_019813065.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]