SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044113 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044113
Domain Number 1 Region: 39-155
Classification Level Classification E-value
Superfamily C-type lectin-like 5.95e-30
Family C-type lectin domain 0.00000754
Further Details:      
 
Domain Number 2 Region: 253-319
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000556
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 3 Region: 198-263
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000528
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 4 Region: 158-201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000762
Family EGF-type module 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044113   Gene: ENSBTAG00000011515   Transcript: ENSBTAT00000046865
Sequence length 371
Comment pep:known_by_projection chromosome:UMD3.1:16:38158186:38173226:-1 gene:ENSBTAG00000011515 transcript:ENSBTAT00000046865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCPWKCQNAQRGLWNVFKLWVWIMLCCDFFAHHGTDCWTYHYSKRPMPWEKARAFCREN
YTDLVAIQNKGEIEYLNKTLPFSRTYYWIGIRKVEGVWTWVGTNKSLTEEAKNWGAGEPN
NRKSKEDCVEIYIKRNKDSGKWNDDACHKAKTALCYTASCKPWSCSGHGQCVEVINNYTC
NCDLGYYGPECQFEVTQCVPLEAPKLGTMACTHPLGNFSFMSQCAFNCSKGTDMIGVEET
TCAPFGNWSSPEPTCRVIQCEPLTEPDLGTMDCNHPLVDFGFSSTCTFSCSEEAELTGEK
KTICGLSGNWSSPSPRCQKINRTISINEESDYNPLFIPVAVMVTAFSGLAFIIWLARRLK
RKSTKLRKSHG
Download sequence
Identical sequences F1N4U9
ENSBTAP00000044113 ENSBTAP00000044113 9913.ENSBTAP00000044113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]