SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044117 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044117
Domain Number 1 Region: 42-159
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-29
Family C-type lectin domain 0.00000182
Further Details:      
 
Domain Number 2 Region: 200-265
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.7e-16
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 260-333
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000334
Family Complement control module/SCR domain 0.00099
Further Details:      
 
Domain Number 4 Region: 697-762
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 5 Region: 446-512
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000264
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 6 Region: 500-566
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000306
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 7 Region: 384-449
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000264
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 8 Region: 571-630
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000389
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 9 Region: 642-708
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000445
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 10 Region: 162-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000108
Family EGF-type module 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044117   Gene: ENSBTAG00000020755   Transcript: ENSBTAT00000046869
Sequence length 830
Comment pep:known chromosome:UMD3.1:16:38049259:38080862:-1 gene:ENSBTAG00000020755 transcript:ENSBTAT00000046869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QASCPKAIWNWRFQRAVFRTVQLLCFSVLIFEVINQKEVSAWTYHYSNKTYSWNYSRAFC
QKYYTDLVAIQNKNEIAYLNETIPYYNSYYWIGIRKINNKWTWVGTNKTLTEEAENWADN
EPNNKRNNQDCVEIYIKSLSAPGKWNDEPCWKRKRALCYRASCQDMSCSKQGECIETIGN
YTCSCYPGFYGPECEYVRECGEFDLPQHVHMNCSHPLGNFSFNSHCSFHCAEGYALNGPS
ELECLASGIWTNSPPQCVAVQCPALKSPEQGSMSCVQSAEAFQHQSSCSFSCEEGFELVG
PEVVHCTALGVWTAPTPVCKAMQCEFLEAPTKGILDCVHPLVSLAGSSCKFECKPCHRVR
GKANCCLGPGWGTPPLPAFKAIACEPLESPVHGSMDCSPSLRAFQYNTSCSFHCAEGFTL
RGADTVRCADMEEWTAPAPVCQTLQCQDLPTSTKARVNCSHPFGDFRYQSTCSFTCDEGS
FLVGASVLQCLDTGNWDAPFPECQAVTCAALPNPQNGEKTCVQPLGGSSYESTCWFTCHE
GFSLSGPERLDCTPSGHWTGSPPTCEEAIKCPELSAPEQGSLDCPDTHGEFIVGSICHFS
CNKGLKLEGSNHVECTPSGRWIAPPPTCKLDTVSAPAPGVQCPTLIAPKQGTMSCQHHVR
NFGLNTTCHFGCKAGFTLLGDSALQCRPSRQWTAAAPTCRAVKCAKLPVTEPIVMNCSNP
WGNFSYGSTCSFHCPEGQLLNGSERTVCQENGQWSTTMPTCQAGPLTIQETLTYVGGAAA
GTTGLVTGSILLALLRRRCRQKDDGKSPLNPQSHLGTYGVFTNAAFDPSP
Download sequence
Identical sequences E1BK92
ENSBTAP00000044117 ENSBTAP00000027661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]