SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044264 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044264
Domain Number 1 Region: 155-263
Classification Level Classification E-value
Superfamily SRCR-like 7.06e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00016
Further Details:      
 
Domain Number 2 Region: 261-364
Classification Level Classification E-value
Superfamily SRCR-like 1.14e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.002
Further Details:      
 
Domain Number 3 Region: 41-159
Classification Level Classification E-value
Superfamily SRCR-like 1.02e-17
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044264   Gene: ENSBTAG00000018367   Transcript: ENSBTAT00000047026
Sequence length 672
Comment pep:known_by_projection chromosome:UMD3.1:29:37892577:37937146:1 gene:ENSBTAG00000018367 transcript:ENSBTAT00000047026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALFFVVAGLLTAALSGHPSPTPSDQPSTTSAESQTLEPGERLQVRLVNGSTRCEGTVEV
WFQQSWQPVCGALWELDASHALCSSLDCGRAHPLELPVLQTPEPPAWAAAGNASWAPNTT
SVLAPAVQCSGPEWLSCKVVERDCRSDEWPAQVNCTDKRDLKLVGGGSPCEGRVEMLEHG
QWGSVCDDTWDLEDAHVVCRQLGCGWAVQALPGLHFAPGQGRIHWDQVNCTGLETYLWHC
PGLPGNGYCGHKEDAGVVCSEHQSWRLTGGTDPCEGQVEVYFRGVWNTVCDSEWYDSEAN
VLCQDLGCGTVARVPKGLPHSLSGKMFYSCKGKESTLSKCFWRFNNSNLCRQSQAARVLC
SGARSLLNLSITEVPASGQPVTVDSSVIVKTKDWESRELMLLIPCIVLGILLLISLVFIA
IILLRMKGKYALPAVVNHQHSPTTTPAGMENYQEVPITIAKEVPKLPIQVQAPPPEDSNS
SSDSDYEHYDFRTQPPVALTTFYNSQRHRFTEEEAQQNRFQMPPLEEGPGLEEVHASEVP
PANLEHCIANPPSLDPPPPHPPRSKSSSSTSSGEMYCNSPSSKRPLWSSQVFSSERNPLL
EQPPNLELAGSQATIPAGPSADDSSSTSSGEWYQNYQRPPQPLSAEQFGCPGSHAPQPDS
SSDEEYDDIGAA
Download sequence
Identical sequences F1MU15
ENSBTAP00000044264 ENSBTAP00000044264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]