SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044315 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044315
Domain Number 1 Region: 48-175
Classification Level Classification E-value
Superfamily L domain-like 2.51e-26
Family Ngr ectodomain-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044315   Gene: ENSBTAG00000033140   Transcript: ENSBTAT00000047081
Sequence length 259
Comment pep:known chromosome:UMD3.1:27:39139085:39139864:-1 gene:ENSBTAG00000033140 transcript:ENSBTAT00000047081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPR
DLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDL
SDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMVSNHETAHNVICKTSVLDEH
AGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISYVVYYVRQNQEDARRHLEYLK
SLPSRQKKADEPDDISTVV
Download sequence
Identical sequences A6H789 L8ISS7
ENSBTAP00000044315 9913.ENSBTAP00000044307 9913.ENSBTAP00000044315 NP_001092865.1.59421 NP_001092865.1.76553 XP_005893246.1.15283 XP_006055939.1.26621 XP_006055940.1.26621 XP_006055941.1.26621 XP_006055942.1.26621 XP_006055943.1.26621 XP_010844719.1.44457 XP_010844720.1.44457 XP_019809175.1.53367 XP_019809177.1.53367 XP_019809180.1.53367 ENSBTAP00000044315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]