SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044340 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044340
Domain Number 1 Region: 335-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000254
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 2 Region: 966-1016
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000586
Family Laminin-type module 0.0015
Further Details:      
 
Domain Number 3 Region: 817-865
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000809
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 4 Region: 919-968
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Laminin-type module 0.054
Further Details:      
 
Domain Number 5 Region: 510-551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000103
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 6 Region: 459-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000246
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 7 Region: 265-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000157
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 8 Region: 398-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000271
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 9 Region: 863-909
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 10 Region: 1030-1078
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000053
Family Laminin-type module 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044340   Gene: ENSBTAG00000033169   Transcript: ENSBTAT00000047110
Sequence length 1097
Comment pep:known_by_projection chromosome:UMD3.1:4:49409615:49472239:-1 gene:ENSBTAG00000033169 transcript:ENSBTAT00000047110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSCVLFLSCFQGLLSYVEAQDECSRGTCQPPTGDLPVGRSGQLTASSTCGLDRAQKYCIL
SYLEGEQKCFICDPRFPYDPHTQPNSHTIENLITSFEPEREKKWWQSENGLDHVSIRLDL
EALFQLSHLILTFKTFRPAAMLVERSTDYGHTWRVFKYFAKDCATSFPNITSGQAQGVGD
LVCDSKYSDIEPSTGGKVVLKVLDPRFEIENPYSPYIQDLVTLTNLRINFTRLHTLGDTL
LGRRQNDSLDKYYYAVYEMVVQGSCFCNGHASECGSTQKMRGDVFSPPGMVYSCSCRCIC
QHNTDGPNCERCKAFFQDVPWRPAMGLLDSACRACHCNGHSDRCHFDVTAYLASGGRSGG
VCDDCQHNTQGQHCDRCRPLFYRDPLKAISDPYACIPCECDPDGTISDGLCVSHSDPDLG
SMTGRCLCKENVEGWKCDRCKPNHYSGLSATDPLGCQSCDCHPLGSLPLLTCDVDTGQCL
CQSFATGLHCEECTAGYWGLENHLHGCSPCDCDVGGAYSNKCSPKNGQCDCRPHVTGRSC
TEPAPGYFFAPLNFYLYEVEEATPLQGLAPLGSVTSDQLPAVSIFLREPVPGIPVSWTGA
GVARVLPGAGLRFAVGNIPVPMDFTVAIRYETQSADDWTIQVINPIGASKHCTRETPQPK
LQALPAASRIMLLPTPICLEPDVQYSLDVYFSQPLEGRLKAHSHILVDSLGLIPQINSLK
NFCSKQDLDEYQLHNCVEIASASGPQVLPGACERLIASLSARLHNGAVACRCHPQGSKGP
SCSRLGGKCQKPGVTGRCCDTCSTGSYGLGQHGCHPCHCHPQGSKSAICDQVTGQCPCHG
EVAGRHCDRCLAGYFGFPNCRPCLCNGFAELCDPETGSCFNCGGRNCERCIDGYYGNPSS
GQSCPPCLCPDVPSSNRYFAHSCYQNLWNSDVICNCLQGYAGVQCEECSAGFYGNPRISG
APCRPCACNNNIDVTDPGSCSPVTGECLKCLYNTQGPNCQLCKPGYFGSALNQTCTRCSC
HPSGVSPTECPPSREACLCDPDAGMCPCLPGVTGRTCDHCADGYWNLLPGRACQPCDCDP
WTSLSSRCDQARNFQLP
Download sequence
Identical sequences F1MTS4
ENSBTAP00000044340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]