SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044341 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044341
Domain Number 1 Region: 338-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000391
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 2 Region: 1060-1110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000067
Family Laminin-type module 0.0015
Further Details:      
 
Domain Number 3 Region: 911-959
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000114
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 4 Region: 513-554
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000156
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 5 Region: 1013-1062
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000251
Family Laminin-type module 0.054
Further Details:      
 
Domain Number 6 Region: 462-506
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 7 Region: 1170-1208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000474
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 8 Region: 267-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000136
Family Laminin-type module 0.057
Further Details:      
 
Domain Number 9 Region: 401-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 10 Region: 957-1003
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000753
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1124-1172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000809
Family Laminin-type module 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044341   Gene: ENSBTAG00000033169   Transcript: ENSBTAT00000047111
Sequence length 1568
Comment pep:known_by_projection chromosome:UMD3.1:4:49384791:49473121:-1 gene:ENSBTAG00000033169 transcript:ENSBTAT00000047111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHLRILSQRFLMKRLLSYVEAQDECSRGTCQPPTGDLPVGRSGQLTASSTCGLDRAQKYC
ILSYLEGEQKCFICDPRFPYDPHTQPNSHTIENLITSFEPEREKKWWQSENGLDHVSIRL
DLEALFQLSHLILTFKTFRPAAMLVERSTDYGHTWRVFKYFAKDCATSFPNITSGQAQGV
GDLVCDSKYSDIEPSTGGKVVLKVLDPRFEIENPYSPYIQDLVTLTNLRINFTRLHTLGD
TLLGRRQNDSLDKYYYAVYEMVVQGSCFCNGHASECGSTQKMRGDVFSPPGMVYSCSCRC
ICQHNTDGPNCERCKAFFQDVPWRPAMGLLDSAWFSACHCNGHSDRCHFDVTAYLASGGR
SGGVCDDCQHNTQGQHCDRCRPLFYRDPLKAISDPYACIPCECDPDGTISDGLCVSHSDP
DLGSMTGRCLCKENVEGWKCDRCKPNHYSGLSATDPLGCQSCDCHPLGSLPLLTCDVDTG
QCLCQSFATGLHCEECTAGYWGLENHLHGCSPCDCDVGGAYSNKCSPKNGQCDCRPHVTG
RSCTEPAPGYFFAPLNFYLYEVEEATPLQGLAPLIVGKVPRRYPSDRVPNQVTHMPVTPA
TEKQKILSCLHDFLPRLLSENHDSPTALPTCSVYFQQQGDDFIIDKGNIILRKNQQSIQA
DEQNEGSVTSDQLPAVSIFLREPVPGIPVSWTGAGVARVLPGAGLRFAVGNIPVPMDFTV
AIRYETQSADDWTIQVINPIGASKHCTRETPQPKLQALPAASRIMLLPTPICLEPDVQYS
LDVYFSQPLEGRLKAHSHILVDSLGLIPQINSLKNFCSKQDLDEYQLHNCVEIASASGPQ
VLPGACERLIASLSARLHNGAVACRCHPQGSKGPSCSRLGGKCQKPGVTGRCCDTCSTGS
YGLGQHGCHPCHCHPQGSKSAICDQVTGQCPCHGEVAGRHCDRCLAGYFGFPNCRPCLCN
GFAELCDPETGSCFNCGGRNCERCIDGYYGNPSSGQSCPPCLCPDVPSSNRYFAHSCYQN
LWNSDVICNCLQGYAGVQCEECSAGFYGNPRISGAPCRPCACNNNIDVTDPGSCSPVTGE
CLKCLYNTQGPNCQLCKPGYFGSALNQTCTRCSCHPSGVSPTECPPSREACLCDPDAGMC
PCLPGVTGRTCDHCADGYWNLLPGRACQPCDCDPWTSLSSRCDQLTGQCPCRLGYDGKRC
SECRNHYEDPLGQCIPCDCNKEGSQKPVCDQDTGTCRCQEGICGPRCDRRAQGHDQEFPT
CLRYRLCFVVQGLIRLAANMEDKRETLPVCEADFKGLRENIQIMQLSEQLKTVDEFEDLK
ETIVRMRNETNLLLEDLQEGNDLHSSAWNANLMEINLPDKSRQKIITSNIAVVISFNNIK
KYYQSSLSTEKKTNETTSIINNSKNTRNDFLHILDTLTSKEDLSLEKLKQIKIPNIQILQ
EKVCGAEEDMACVLSSCGSPSCYGSPALSRNALQKAQEAESVVHSLNSQVHRLKKQIRNI
SKLAEVCKKSTLQLRKKLRDMKSQSESEEQKMNLLIKKTENIFLEDNENVPPEDIEKVAN
RALDIHLP
Download sequence
Identical sequences F1MTS3
ENSBTAP00000044340 ENSBTAP00000044341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]