SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044349 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044349
Domain Number 1 Region: 45-248
Classification Level Classification E-value
Superfamily L domain-like 4.42e-41
Family Ngr ectodomain-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044349   Gene: ENSBTAG00000033170   Transcript: ENSBTAT00000047119
Sequence length 371
Comment pep:known chromosome:UMD3.1:1:65680766:65700685:-1 gene:ENSBTAG00000033170 transcript:ENSBTAT00000047119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVGGAVATAGEAELNLSRLSVSLETLESELEARGEERRGAREALLRLLLPHNRLVSLP
RALGSGFPHLQLLDVSGNALTALGPELLALRGLRTLLAKNNRLGGPGAFPKGLAQSPLCR
SLQVLNLSGNCFQEVPTSLLELRALQTLSLGGNQLQSIPAEIENLRSLECLYLGGNFIKE
IPPELGNLPSLNYLVLCDNKIQSVPPQLSQLHSLRSLSLHNNLLTYLPREILNLIHLEEL
SLRGNPLVVRFVRDLTYDPPTLLELAARTIKIRNISYTPYDLPGNLLRYLSLASNCPNPK
CGGVYFDCCVRQIKFVDFCGKYRLPLMHYLCSPECSSPCSSASHSSTSQSESDSEDEASV
AAHRMQKVLLG
Download sequence
Identical sequences F1MTP8
ENSBTAP00000044349 ENSBTAP00000044349 NP_001193689.1.59421 NP_001193689.1.76553 XP_019843153.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]