SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044383 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044383
Domain Number 1 Region: 49-200
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000166
Family SPRY domain 0.051
Further Details:      
 
Domain Number 2 Region: 244-333
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000396
Family SPRY domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044383   Gene: ENSBTAG00000021464   Transcript: ENSBTAT00000047161
Sequence length 436
Comment pep:known_by_projection chromosome:UMD3.1:5:27054242:27067451:1 gene:ENSBTAG00000021464 transcript:ENSBTAT00000047161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRTRRPRFVLMNKMDDLNLHYRFLNWRRRIREIREVRAFRYQERFKHILVDGDTLSYHG
NSGEVGCYVASRPLTKDSNYFEVSIVDSGVRGTIAVGLVPQYYSLDHQPGWLPDSVAYHA
DDGKLYNGRAKGRQFGSKCNSGDRIGCGIEPVSFDVQTAQIFFTKNGKRVGSTIMPMSPD
GLFPAVGMHSLGEEVRLHLNAELGREDDSVMMVDSYEDEWGRLHDVRVCGTLLEYLGKGK
SIVDVGLAQARRPLSTRSHYFEVEIVDPGEKCYIALGLARKDYPKNRHPGWSRGSVAYHA
DDGKIFHGSGVGDPFGPRCYKGDIMGCGIMFPRDYILDSEGDSDDSCDTVILSPTARAVR
NVRNVMYLHQEGEEEEEEEEEEDDGEEIEQEHEGKKVVVSAGGKKDAVVPSGGFFPTIGM
LSCGEKVKVDLHPLSG
Download sequence
Identical sequences E1BET7
ENSBTAP00000044383 ENSBTAP00000044383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]