SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044478 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044478
Domain Number 1 Region: 442-699
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-49
Family YWTD domain 0.0000000944
Further Details:      
 
Domain Number 2 Region: 233-272
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000183
Family LDL receptor-like module 0.0005
Further Details:      
 
Domain Number 3 Region: 32-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000055
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 4 Region: 153-191
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000128
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 5 Region: 271-311
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000432
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 6 Region: 70-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.00053
Further Details:      
 
Domain Number 7 Region: 107-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.00017
Further Details:      
 
Domain Number 8 Region: 395-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000729
Family EGF-type module 0.0012
Further Details:      
 
Domain Number 9 Region: 359-402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000195
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 10 Region: 317-354
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.00036
Further Details:      
 
Domain Number 11 Region: 703-749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000994
Family EGF-type module 0.0011
Further Details:      
 
Domain Number 12 Region: 203-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000144
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044478   Gene: ENSBTAG00000018517   Transcript: ENSBTAT00000047258
Sequence length 844
Comment pep:known chromosome:UMD3.1:8:42109679:42141155:-1 gene:ENSBTAG00000018517 transcript:ENSBTAT00000047258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTSARWALWLLLLLCWAPRESGATGAGRKAKCEANQFQCTNGRCITLLWKCDGDEDCTD
GSDEKNCVKKTCAESDFVCNNGQCVPNRWQCDGDPDCEDGSDESPEQCHMRTCRINEISC
GARSTQCIPVSWRCDGENDCDSGEDEENCGNVTCSSDEFTCSSGRCISRNFMCNGQDDCS
DGSDELDCAPPTVGPTSSSAAPSCIPISWVCDDDADCSDQSDESLEQCGRQPVIHTRCPA
SEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCIHGSRQCNGIR
DCVDGSDEVNCKNVNQCLGPGKFKCRSGECIDISKVCNQKQDCRDWSDEPLKECHVNECL
VNNGGCSHICKDLVIGYECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCEC
SRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAAQ
KLFWADLSQKAIFSASIDDKVGRHVKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVAT
LDGTKRKFLFNSDLREPASIAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRRALVTADIQW
PNGITLDLIKGRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWID
GENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEEDVENGGCEYLCLP
APQINDHSPKYTCSCPNGYNLEDNGRECHRINVTTAVSEVSVPPKGTSAAWAILPLLLLA
MAAVGGYLMWRNWQHKNMKSMNFDNPVYLKTTEEDLSIDIGRHSASVGHTYPAISVVSTD
DDLA
Download sequence
Identical sequences F1MIQ2
ENSBTAP00000044478 ENSBTAP00000044478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]